KEGG   Shigella flexneri 301 (serotype 2a): SF0249Help
Entry
SF0249            CDS       T00097                                 

Gene name
hemB
Definition
(RefSeq) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00860  Porphyrin and chlorophyll metabolism
sfl01100  Metabolic pathways
sfl01110  Biosynthesis of secondary metabolites
sfl01120  Microbial metabolism in diverse environments
Module
sfl_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SF0249 (hemB)
Enzymes [BR:sfl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SF0249 (hemB)
Exosome [BR:sfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SF0249 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ComA
Motif
Other DBs
NCBI-GeneID: 1024339
NCBI-ProteinID: NP_706203
UniProt: P0ACB3
Position
268341..269348
Genome map
AA seq 335 aa AA seqDB search
MHLNSTNIRQTMTDLIQRPRRLRKSPALRAMFEETTLSLNDLVLPIFVEEEIDDYKAVEA
MPGVMRIPEKHLAREIERIANAGIRSVMTFGISHHTDETGSDAWREDGLVARMSRICKQT
VPEMIVMSDTCFCEYTSHGHCGVLCEHGVDNDATLENLGKQAVVAAAAGADFIAPSAAMD
GQVQAIRQALDAAGFKDTAIMSYSTKFASSFYGPFREAAGSALKGDRKSYQMNPMNRREA
IRESLLDEAQGADCLMVKPAGAYLDIVRELRERTELPIGAYQVSGEYAMIKFAALAGAID
EEKVVLESLGSIKRAGADLIFSYFALDLAEKKILR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgcaccttaattccacaaacatcaggcagaccatgacagacttaatccaacgccctcgt
cgcctgcgcaaatctcctgcgctgcgcgctatgtttgaagagacaacacttagccttaac
gacctggtgttgccgatctttgttgaagaagaaattgacgactacaaagccgttgaagcc
atgccaggcgtgatgcgcattccagagaaacatctggcacgcgaaattgaacgcatcgcc
aacgccggtatccgttccgtaatgacttttggcatctctcaccataccgatgaaaccggc
agcgacgcctggcgggaagatggactggtggcgcgtatgtcgcgcatctgcaagcagact
gtgccagaaatgatcgtcatgtcagacacttgtttctgtgaatacacttctcacggtcac
tgcggtgtgctgtgcgagcatggcgtcgacaacgacgcgactctggaaaatttaggcaag
caagccgtggttgcagctgctgcaggcgcagacttcatcgccccttccgccgcgatggac
ggccaggtacaggcgattcgtcaggcgctggacgctgcaggctttaaagatacggcgatt
atgtcgtattcgaccaagttcgcctcttccttttatggcccgttccgtgaagctgcagga
agcgcattaaaaggcgaccgcaaaagctatcagatgaacccaatgaaccgtcgcgaggcg
attcgtgagtcactgctggatgaagcccagggcgcagactgcctgatggttaaacctgct
ggagcgtacctcgacatcgtgcgtgagctgcgtgaacgtactgaattgccgattggcgcg
tatcaggtgagcggtgagtacgcgatgattaagttcgccgcgctggcgggtgctatagat
gaagagaaagtcgtgctcgaaagcttaggttcaattaagcgtgcgggtgcggatctgatt
ttcagctactttgcgctggatttggctgagaagaagattctgcgttaa

DBGET integrated database retrieval system