KEGG   Shigella flexneri 301 (serotype 2a): SF0401Help
Entry
SF0401            CDS       T00097                                 

Gene name
ybaA
Definition
(RefSeq) hypothetical protein
Organism
sfl  Shigella flexneri 301 (serotype 2a)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1428 NIPSNAP
Motif
Other DBs
NCBI-GeneID: 1027736
NCBI-ProteinID: NP_706350
UniProt: P0AAQ9 A0A226K5Q0
Structure
PDB: 

Jmol
Position
413203..413556
Genome map
AA seq 117 aa AA seqDB search
MKYVDGFVVAVPADKKDAYREMAAKAAPLFKEFGALRIVECWASDVPDGKVTDFRMAVKA
EENEEVVFSWIEYPSKEVRDAANQKMMSDPRMKEFGESMPFDGKRMIYGGFESIIDE
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatgttgatggttttgtggttgccgttcctgccgataaaaaggatgcctatcgg
gaaatggccgctaaggccgcgccattgtttaaagagtttggcgcgcttcgtattgtcgaa
tgctgggccagcgatgtgccggatggcaaagtgaccgattttcgtatggcggtgaaagcg
gaagagaatgaagaggttgtctttagctggattgaatacccttcaaaagaggtccgcgac
gcagctaatcaaaagatgatgtcggacccacggatgaaagagttcggcgagtccatgccg
tttgacggcaagcgaatgatctatggcggattcgagtcaatcatcgacgaatag

DBGET integrated database retrieval system