KEGG   Shigella flexneri 301 (serotype 2a): SF0619Help
Entry
SF0619            CDS       T00097                                 

Gene name
asnB
Definition
asparagine synthetase AsnB
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SF0619 (asnB)
Enzymes [BR:sfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SF0619 (asnB)
Peptidases [BR:sfl01002]
 Cysteine Peptidases
  Family C44
   SF0619 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652658..654205
Genome map
AA seq 515 aa AA seqDB search
MCSIFGVFDIKTDAVELRKKALELSRLMRHRGPDWSGIYASDNAILAHERLSIVDVNAGA
QPLYNQQKNHVLAVNGEIYNHQALRAEYGDRYQFQTGSDCEVILALYQEKGPEFLDDLQG
MFAFALYDSEKDAYLIGRDHLGIIPLYMGYDEHGQLYVASEMKSLVPVCRTIKEFPAGSY
LWSQDGEIRSYYHRDWFDFDAVKDNVTDKNELRQALEDSVKSHLMSDVPYGVLLSGGLDS
SIISAITKKYAARRVHHEIHFTVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKA
MGIKMVLSGEGSDEVFGGYLYFHKAPNVKELHEETVRKLLALHMYDCARANKAMSAWGVE
ARVPFLDKKFLDVAMRINPQDKMCGNGKMEKHILRECFESYLPASVAWRQKEQFSDGVGY
SWIDTLKEVAAQQVSDQQLETARFRFPYNTPTSKEAYLYREIFEELFPLPSAAECVPGGP
SVACSSAKAIEWDEAFKKMDDPSGRAVGVHQSAYK
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatttttggcgtattcgatatcaaaacagacgcagttgagctgcgtaagaaa
gcactcgagctgtcacgcctgatgcgtcatcgtggcccggactggtccggtatttatgcc
agcgataacgccattctcgctcacgaacgtctgtcaattgttgacgttaacgcgggggcg
caacctctctacaaccaacaaaaaaaccacgtactggcggtaaacggtgaaatctacaac
caccaggcattgcgcgctgaatatggcgatcgttatcagttccagacagggtctgactgt
gaagtgatcctcgcgctgtatcaggaaaaagggccggaatttctcgacgacttgcagggc
atgtttgcctttgccctgtacgacagcgaaaaagatgcctacctgattggtcgcgaccat
ctggggatcatcccactgtatatggggtatgacgaacacggtcagctgtatgtggcctca
gaaatgaaatcgctggtgccagtttgccgcacgattaaagagttcccggcggggagctat
ttgtggagtcaggacggcgaaatccgttcttattatcatcgcgactggttcgactttgat
gcagtgaaagataacgtgaccgacaaaaacgagctgcgtcaggcactggaagattccgtt
aaaagccatctgatgtctgatgtgccttacggtgtgctactttctggtggtctggattcc
tcaattatttccgctatcaccaagaaatacgcagcccgtcgcgtgcatcacgaaattcac
ttcactgtacaggaaggtctggatgccatccgcgacgtgatttaccacatcgaaacttat
gatgtgaccactattcgcgcttcaacaccgatgtatttaatgtcgcgtaagatcaaggcg
atgggcattaaaatggtgctgtccggtgaaggttctgatgaagtgtttggcggttatctt
tacttccataaagcgcccaacgttaaagaactgcatgaagagacggtgcgtaaactgctg
gccttgcatatgtatgactgcgcgcgcgccaacaaagcgatgtcagcctggggcgtggaa
gcacgcgttccgttcctcgacaaaaaattccttgatgtggcgatgcgcattaacccgcag
gataaaatgtgcggtaacggcaaaatggaaaaacacatcctgcgtgaatgttttgagtca
tacctgcccgcaagcgtggcctggcggcagaaagagcagttctccgatggcgtcggttac
agttggatcgacaccctgaaagaagtggcggcgcagcaggtttctgatcagcaactggaa
actgcccgcttccgcttcccgtacaacacgccgacctcaaaagaagcgtatctgtaccgc
gagatctttgaagaactgttcccacttccgagtgccgctgagtgcgtgccgggcggtcct
tccgtcgcgtgttcttcagctaaagcgatcgaatgggatgaagcgttcaaaaaaatggac
gatccgtctggtcgtgcggttggcgttcaccagtcggcgtataagtaa

DBGET integrated database retrieval system