KEGG   Shigella flexneri 301 (serotype 2a): SF0691Help
Entry
SF0691            CDS       T00097                                 

Definition
endolysin R of prophage CP-933V
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Brite
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     SF0691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
722382..722915
Genome map
AA seq 177 aa AA seqDB search
MSAKIKYGLSAAVLALIAAGASAPQILDQFLNEKEGNHTTAYRDGSGIWTICRGATMVDG
KPVIPGMKLSKEKCDQVNAIERDKALAWVERNIKVPLTEPQKAGIASFCPYNIGPGKCFP
STFYKRLNAGDRKGACEAIRWWIKDVGRDCRIRSNNCYGQVIRRDQESALACWGIDQ
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaaaaatcaaatacggcctgtcggctgctgttctggcgctgattgccgcaggc
gcgtctgctccccagatacttgaccagtttctgaacgaaaaagagggtaatcacacaacg
gcataccgtgatggttctggcatatggaccatctgtcgtggtgccacaatggtggatggt
aagcctgtcataccgggaatgaagctgtcgaaggaaaaatgtgaccaggttaacgctatt
gaacgtgataaggcgctggcatgggtggagcgcaatattaaagtacctctgaccgaaccc
cagaaagcgggtatagcgtcattttgcccctataacattggccccggtaagtgtttcccg
tcgacgttttataagcggctgaatgccggtgatcgtaagggcgcatgcgaggcgattcgc
tggtggataaaagatgttgggcgcgattgccgcatacgttcaaataactgctatggacag
gttattcgtcgtgaccaggaaagcgcattagcctgttgggggatagatcaatga

DBGET integrated database retrieval system