KEGG   Shigella flexneri 301 (serotype 2a): SF0928Help
Entry
SF0928            CDS       T00097                                 

Gene name
pncB
Definition
(RefSeq) nicotinate phosphoribosyltransferase
  KO
K00763  
nicotinate phosphoribosyltransferase [EC:6.3.4.21]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SF0928 (pncB)
Enzymes [BR:sfl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.21  nicotinate phosphoribosyltransferase
     SF0928 (pncB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(974376..975578)
Genome map
AA seq 400 aa AA seqDB search
MTQFASPVLHSLLDTDAYKLHMQQAVFHHYYDVHVAAEFRCRGDDLLGIYADAIREQIQA
MQHLRLQDDEYQWLSALPFFKADYLNWLREFRFNPEQVTVSNDNGKLDIRLSGPWREVIL
WEVPLLAVISEMVHRYRSPQADVAQALDTLESKLVDFSALTAGLDMSRFHLMDFGTRRRF
SREVQETIVKRLQQESWFVGTSNYDLARRLSLTPMGTQAHEWFQAHQQISPDLANSQRAA
LAAWLEEYPDQLGIALTDCITMDAFLRDFGVEFASRYQGLRHDSGDPVEWGEKAIAHYEK
LGIDPQSKTLVFSDNLDLRKAVELYRHFSSRVQLSFGIGTRLTCDIPQVKPLNIVIKLVE
CNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPHIKKAS
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacacaattcgcttctcctgttctgcactcgttgctggatacagatgcttataagttg
catatgcagcaagccgtgtttcatcactattacgatgtgcatgtcgcggcggagtttcgt
tgccgaggtgacgatctgctgggtatttatgccgatgctattcgtgaacagattcaggcg
atgcagcacctgcgcctgcaggatgatgaatatcagtggctctctgccctgcctttcttt
aaggccgactatcttaactggttacgcgagttccgctttaacccggaacaagtcaccgtg
tccaacgataatggcaagctggatattcgcttaagcggtccgtggcgtgaagtcatcctc
tgggaagttcctttgctggcggttatcagtgaaatggtacatcgctatcgctcaccgcag
gccgacgttgcgcaagccctcgacacgctggaaagcaaattagtcgacttctcggcgtta
accgccggtcttgatatgtcgcgcttccatctgatggattttggcacccgtcgccgtttt
tctcgcgaagtacaagaaaccatcgttaagcgtctgcaacaggaatcctggttcgtgggc
accagcaactacgatctggcgcgtcggctttccctcacgccgatgggaacacaggcacac
gaatggttccaggcacatcagcaaatcagcccggatctagccaacagccagcgagctgca
cttgctgcctggctggaagagtatcccgaccaacttggcattgcattaaccgactgcatc
actatggatgctttcctgcgtgatttcggtgtcgagttcgctagtcggtatcagggcctg
cgtcatgactctggcgacccggttgaatggggtgaaaaagccattgcacattatgaaaag
ctgggaattgatccacagagtaaaacgctggttttctctgacaatctggatttacgcaaa
gcggttgagctataccgccacttctcttcccgcgtgcaattaagttttggtattgggact
cgcctgacctgcgatatcccccaggtaaaacccctgaatattgtgattaagttggtagag
tgtaacggtaaaccggtggcgaaactttctgacagccctggcaaaactatctgccatgat
aaagcgtttgttcgggcactgcgcaaagcgttcgaccttccgcatattaaaaaagccagt
taa

DBGET integrated database retrieval system