KEGG   Shigella flexneri 301 (serotype 2a): SF1455Help
Entry
SF1455            CDS       T00097                                 

Gene name
ydjB
Definition
hypothetical protein
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SF1455 (ydjB)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     SF1455 (ydjB)
    3.5.1.-  
     SF1455 (ydjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1490225..1490884)
Genome map
AA seq 219 aa AA seqDB search
MIKETAMPHRALLLVDLQNDFCAGGALAVPEGDSTVEVANRLIDWCQSRGEAVIASQDWH
PANHGSFASQHGVEPYTPGQLGGLRQTFWPEHCVQNSEGAQLHPLLNQKEIAAVFHKGEN
PLVDSYSAFFDNGRRQKTALDDWLRDHEIDELIVMGLATDYCVKFTVLDALQLGYKVNVI
TDGCRGVNIQPQDSAHAFMEMSAAGATLYTLADWEETQG
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgattaaggagactgcaatgccccatcgcgccctgttactggtcgatttacaaaatgat
ttctgtgctggtggcgcgctcgccgtaccggaaggtgacagtacggtggaggttgctaac
cgccttattgactggtgccagtcgcgcggagaagcggttatcgccagccaggactggcat
ccggcgaatcacggcagctttgccagccagcacggcgtagagccttatacgccaggccaa
ctcggcggcctgcggcaaactttctggcctgaacactgtgtgcagaacagtgaaggcgca
caattacatccgttactgaatcaaaaagagatcgcagcggtgttccataaaggcgaaaat
cctttagttgacagttacagtgccttttttgataacggacgtcggcagaaaaccgcgctt
gatgactggttgcgcgatcatgaaatcgatgaattgatcgttatgggcctggctactgac
tattgcgtgaagtttaccgtgctggacgcgttacagttaggttataaggtaaacgtgatt
accgatggctgtcgtggcgtgaatatccagccccaggacagtgcacacgcgtttatggag
atgtcagcagctggggcaacgctatatacgctggcagactgggaagagacgcaggggtaa

DBGET integrated database retrieval system