KEGG   Shigella flexneri 301 (serotype 2a): SF1747Help
Entry
SF1747            CDS       T00097                                 

Gene name
adhP
Definition
(RefSeq) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00010  Glycolysis / Gluconeogenesis
sfl00071  Fatty acid degradation
sfl00350  Tyrosine metabolism
sfl00625  Chloroalkane and chloroalkene degradation
sfl00626  Naphthalene degradation
sfl01100  Metabolic pathways
sfl01110  Biosynthesis of secondary metabolites
sfl01120  Microbial metabolism in diverse environments
sfl01130  Biosynthesis of antibiotics
sfl01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SF1747 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SF1747 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SF1747 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SF1747 (adhP)
   00626 Naphthalene degradation
    SF1747 (adhP)
Enzymes [BR:sfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SF1747 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 Methyltransf_31 2-Hacid_dh_C Phage_holin_2_1 DUF2284
Motif
Other DBs
NCBI-GeneID: 1024935
NCBI-ProteinID: NP_707612
UniProt: Q83R96 A0A226K6Z5
Position
1783645..1784655
Genome map
AA seq 336 aa AA seqDB search
MKTAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMEEE
CIVVADYAVKVPDGLDSAAPSSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMDADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRH
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagactgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggc
atcggtgtggtggcagaagttggcccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttttacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggaggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcgccc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaaactgtcaaaaattcgt
cccggtcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcaaagaatgtctttaacgccaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatggatgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggcattgaagtggtc
ggttcgctggtcggcacgcgccaggatctaaccgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgtcactaa

DBGET integrated database retrieval system