KEGG   Shigella flexneri 301 (serotype 2a): SF1871Help
Entry
SF1871            CDS       T00097                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SF1871 (ruvA)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SF1871 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1909237..1909848)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREEVGPLVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPASPATDDAEQEAVAALVALGYKPQEASRM
VSKIARPDTSSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgctggtgttaattgaa
gtgggcggcgtaggctatgaagtgcatatgccgatgacctgtttttatgaactccctgaa
gcgggtcaggaagcgatcgttttcacccactttgtggtgcgtgaagacgcgcaactgctg
tacggttttaacaataaacaagaacgcacgttgttcaaagagttgatcaaaaccaacggc
gtcggcccgaagttggccctggcgatcctctccggaatgtcagcgcagcagttcgttaat
gccgttgagcgtgaagaagtggggccactggtgaaactgccgggtattggcaaaaaaacc
gccgaacgcttgattgttgaaatgaaagaccgatttaaaggtttgcatggcgatctcttt
acgccagccgccgacctggtactcacgtctcctgctagcccggcgaccgacgatgctgaa
caagaagcagttgccgcgctggtggcgctaggctataaaccacaagaagcaagccgcatg
gtgagcaaaatcgctcgccctgacaccagcagtgaaacattaattcgcgaagccctacgc
gccgcgttatga

DBGET integrated database retrieval system