KEGG   Shigella flexneri 301 (serotype 2a): SF2082Help
Entry
SF2082            CDS       T00097                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SF2082 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    SF2082 (hisD)
Enzymes [BR:sfl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SF2082 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2097434..2098738
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCTAEQQRQLLMRPAISASESITRTVNDILDNVKTRGDEALREYSAKFDK
TTVTALKVSADEIAAASERLSDELKQAMAVAVKSIETFHTAQKLPPVDVETQLGVRCQQV
TRPVASVGLYIPGGSAPLFSTVLMLATPARIAGCKKVVLCSPPPIADEILYAAQLCDVQD
VFNVGGAQAIAALAFGTESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMARRVAEAVERQLAELPRAETTRQ
ALNASRLIVTKDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKEGFSALASTIETLAAAERLTAHK
NAVTLRVNVLKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaacacaatcattgactggaatagctgtactgcggagcaacaacgccagctg
ttaatgcgcccggcgatctccgcttctgaaagcattacccgcaccgttaacgatattctc
gataacgtgaaaacgcgtggcgatgaggccctgcgtgaatacagcgcgaagtttgataaa
accacggttaccgcgctgaaggtgtctgctgatgagatcgccgccgccagcgaacgcctg
agcgacgagctaaaacaggcgatggcggtggcagtaaagagtattgaaaccttccacact
gcgcaaaaactgccgccggtagatgtagaaacgcagctaggcgtgcgttgccagcaggtc
acgcgcccggtggcttcagtgggtttgtatattccgggcggctccgccccgctcttctca
acggtattaatgctggcaactccggcgcgtattgcgggctgtaaaaaagtggtgctgtgc
tcaccgccgccgattgccgatgaaattctttatgcggcgcagctgtgcgatgtgcaggac
gtgtttaacgtcggcggcgcacaggccattgccgcgctggcgtttggtacggaatctgtg
ccgaaagtggacaaaatcttcgggccgggtaacgcctttgtcaccgaagcaaaacgccag
gtaagccagcgtctggacggtgcggcgatcgatatgcccgcaggcccgtcggaagtgctg
gtgattgctgacagcggcgctacgccggattttgtggcttctgatttgctttctcaggct
gaacacggccctgactcacaggtaattttactgacccccgatgctgatatggcgcgtcgc
gttgccgaggccgtcgaacgccaactggcagaactgccgcgtgccgaaaccacccgccag
gcactgaacgccagccgcctgatcgtgactaaagatttagcgcagtgcgtggagatctcc
aaccagtacggcccggagcacctgatcattcagacccgcaacgcccgcgaactggtcgat
ggcatcaccagcgccggttcggtatttcttggtgactggtcaccggaatcggcaggcgac
tacgcctccggcaccaaccacgtgctgccgacttacggttacaccgccacctgttccagc
ctcgggctggcagatttccagaaacgcatgaccgtacaggaactgtcgaaagaaggtttc
tccgcgctggcttcgaccattgaaacactggccgccgccgagcgcctgaccgcccacaaa
aatgccgttactttgcgtgttaacgtccttaaggagcaagcatga

DBGET integrated database retrieval system