KEGG   Shigella flexneri 301 (serotype 2a): SF3217Help
Entry
SF3217            CDS       T00097                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3316245..3317138)
Genome map
AA seq 297 aa AA seqDB search
MLRGFFLSIHTRDNIMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHAN
LMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRE
SAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYF
IEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIG
QLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctccggggttttttcttatcaattcataccagggataacataatgaaactctttgcc
cagggtacttcactggaccttagccatcctcacgtaatggggatcctcaacgtcacgcct
gattccttttcggatggtggcacgcataactcgctgatagatgcggtgaaacatgcgaat
ctgatgatcaatgctggcgcgacgatcattgacgttggtggcgagtccacgcgcccaggg
gcggcggaagttagcgttgaagaagagttgcaacgtgttattcctgtggttgaggcaatt
gctcaacgcttcgaagtctggatctcggtcgatacatccaaaccagaagtcatccgtgag
tcagcgaaagttggcgctcacattattaatgatatccgctccctttccgaacctggcgct
ctggaggcggctgcagaaaccggtttaccggtttgtctgatgcatatgcagggaaatcca
aaaaccatgcaggaagctccgaagtatgacgatgtctttgcagaagtgaatcgctacttt
attgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagagaaattgttgctcgac
cccggattcggtttcggtaaaaatctctcccataactattcattactggcgcgcctggct
gaatttcaccatttcaacctgccgctgttggtgggtatgtcacgaaaatcgatgattggg
cagctgctgaacgtggggccgtccgagcgcctgagcggtagtctggcctgtgcggtcatt
gccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaagaaaccgtagaagcg
atgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgctatgagtaa

DBGET integrated database retrieval system