KEGG   Shigella flexneri 301 (serotype 2a): SF3217Help
Entry
SF3217            CDS       T00097                                 

Gene name
folP
Definition
(RefSeq) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
sfl00790  Folate biosynthesis
sfl01100  Metabolic pathways
Module
sfl_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SF3217 (folP)
Enzymes [BR:sfl01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SF3217 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-GeneID: 1027106
NCBI-ProteinID: NP_708976
UniProt: P0AC15
Position
complement(3316245..3317138)
Genome map
AA seq 297 aa AA seqDB search
MLRGFFLSIHTRDNIMKLFAQGTSLDLSHPHVMGILNVTPDSFSDGGTHNSLIDAVKHAN
LMINAGATIIDVGGESTRPGAAEVSVEEELQRVIPVVEAIAQRFEVWISVDTSKPEVIRE
SAKVGAHIINDIRSLSEPGALEAAAETGLPVCLMHMQGNPKTMQEAPKYDDVFAEVNRYF
IEQIARCEQAGIAKEKLLLDPGFGFGKNLSHNYSLLARLAEFHHFNLPLLVGMSRKSMIG
QLLNVGPSERLSGSLACAVIAAMQGAHIIRVHDVKETVEAMRVVEATLSAKENKRYE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
gtgctccggggttttttcttatcaattcataccagggataacataatgaaactctttgcc
cagggtacttcactggaccttagccatcctcacgtaatggggatcctcaacgtcacgcct
gattccttttcggatggtggcacgcataactcgctgatagatgcggtgaaacatgcgaat
ctgatgatcaatgctggcgcgacgatcattgacgttggtggcgagtccacgcgcccaggg
gcggcggaagttagcgttgaagaagagttgcaacgtgttattcctgtggttgaggcaatt
gctcaacgcttcgaagtctggatctcggtcgatacatccaaaccagaagtcatccgtgag
tcagcgaaagttggcgctcacattattaatgatatccgctccctttccgaacctggcgct
ctggaggcggctgcagaaaccggtttaccggtttgtctgatgcatatgcagggaaatcca
aaaaccatgcaggaagctccgaagtatgacgatgtctttgcagaagtgaatcgctacttt
attgagcaaatagcacgttgcgagcaggcgggtatcgcaaaagagaaattgttgctcgac
cccggattcggtttcggtaaaaatctctcccataactattcattactggcgcgcctggct
gaatttcaccatttcaacctgccgctgttggtgggtatgtcacgaaaatcgatgattggg
cagctgctgaacgtggggccgtccgagcgcctgagcggtagtctggcctgtgcggtcatt
gccgcaatgcaaggcgcgcacatcattcgtgttcatgacgtcaaagaaaccgtagaagcg
atgcgggtggtggaagccactctgtctgcaaaggaaaacaaacgctatgagtaa

DBGET integrated database retrieval system