KEGG   Shigella flexneri 301 (serotype 2a): SF4004Help
Entry
SF4004            CDS       T00097                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SF4004 (glpK)
Enzymes [BR:sfl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SF4004 (glpK)
Exosome [BR:sfl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SF4004 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4130791..4132149)
Genome map
AA seq 452 aa AA seqDB search
MEIWATQSSTLVEVLAKADISSDQIAAIGITNQRETTIVWEKETGKPIYNAIVWQCRRTA
EICEHLKRDGLEDYIRSNTGLVLDPYFSGTKVKWILDHVEGSHERARRGELLFGTVDTWL
IWKMTQGRVHVTDYTNASRTMLFNIHTLDWDDKMLEVLDIPREMLPEVRRSSEVYGQTNI
GGKGGTRIPISGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTT
IACGPTGEVNYALEGAVFMAGASIQWLRDEMKLINDAYDSEYFATKVQNTNGVYVVPAFT
GLGAPYWDPYARGAIFGLTRGVNANHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVD
GGAVANNFLMQFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIERE
FRPGIETTERNYRYAGWKKAVKRAMAWEEHDE
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaaatctgggccacccaaagctccacgctggtagaagtgctggcgaaagccgatatc
agttccgatcaaattgcagctatcggtattacgaaccagcgtgaaaccactattgtctgg
gaaaaagaaaccggcaagcctatctataacgccattgtctggcagtgccgtcgtaccgca
gaaatctgcgagcatttaaaacgtgacggtttagaagattatatccgcagcaataccggt
ctggtgcttgacccgtacttttctggcaccaaagtgaagtggatcctcgaccatgtggaa
ggctctcacgagcgtgcacgtcgtggtgaattgctgtttggtacggttgatacgtggctt
atctggaaaatgactcagggccgtgtccatgtgaccgattacaccaacgcctctcgtacc
atgttgttcaacatccataccctggactgggacgacaaaatgctggaagtgctggatatt
ccgcgcgagatgctgccagaagtgcgtcgttcttccgaagtatacggtcagactaacatt
ggcggcaaaggcggcacgcgtattccaatctccgggatcgccggtgaccagcaggccgcg
ctgtttggtcagttgtgcgtgaaagaagggatggcgaagaacacctatggcactggctgc
tttatgctgatgaacactggcgagaaagcggtgaaatcagaaaacggcctgctgaccacc
atcgcctgcggcccgactggcgaagtgaactatgcgttggaaggtgcggtgtttatggca
ggcgcatccattcagtggctgcgcgatgagatgaagttgattaacgacgcctacgattcc
gaatatttcgccaccaaagtgcaaaacaccaatggtgtgtatgtggttccggcatttacc
gggctgggtgcgccgtactgggacccgtatgcgcgcggggcgattttcggtctgactcgt
ggggtgaacgctaaccacattatacgcgcgacgctggagtctattgcttatcagacgcgt
gacgtgctggaagcgatgcaggccgactctggtatccgtctgcacgccctgcgcgtggat
ggtggcgcagtagcaaacaatttcctgatgcagttccagtccgatattctcggcacccgc
gttgagcgcccggaagtgcgcgaagtcaccgcattgggtgcggcctatctcgcaggcctg
gcggttggcttctggcagaacctcgacgagctgcaagagaaagcggtgattgagcgcgag
ttccgtccaggcatcgaaaccactgagcgtaattaccgttacgcaggctggaaaaaagcg
gtcaaacgcgcgatggcgtgggaagaacacgacgagtaa

DBGET integrated database retrieval system