KEGG   Shigella flexneri 301 (serotype 2a): SF4229Help
Entry
SF4229            CDS       T00097                                 

Gene name
pepA
Definition
multifunctional aminopeptidase A
Orthology
K01255  
leucyl aminopeptidase [EC:3.4.11.1]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Glutathione metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfl00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SF4229 (pepA)
Enzymes [BR:sfl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.1  leucyl aminopeptidase
     SF4229 (pepA)
Peptidases [BR:sfl01002]
 Metallo Peptidases
  Family M17: leucyl aminopeptidase family
   SF4229 (pepA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4401645..4403156
Genome map
AA seq 503 aa AA seqDB search
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKPGQTL
LLHHVPNVLSERILLIGCGKERELDERQYKQVIQKTINTLNDTGSMEAVCFLTELHVKGR
NNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFNVPTRRELTSGERAIQHGQAI
AAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKELGMHSYLAVG
QGSQNESLMSVIEYKGNASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
YGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNTDAEGRLVLC
DVLTYVERFEPEAVIDVATLTGACVIALGHHITGLMTNHNPLAHELIAASEQSGDRAWRL
PLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAWRSGKAKG
ATGRPVALLAQFLLNRAGFNGEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagtttagtgtaaaaagcggtagcccggagaaacagcggagtgcctgcatcgtcgtg
ggcgtcttcgaaccacgtcgcctttctccgattgcagaacagctcgataaaatcagcgat
gggtacatcagcgccctgctacgccggggcgaactggaaggaaaaccggggcagacattg
ttgctgcaccatgttccgaatgtactttccgagcgaattctccttattggttgcggcaaa
gaacgtgagctggatgagcgtcagtacaagcaggttattcagaaaaccattaatacgctg
aatgatactggctcgatggaagcggtctgctttctgactgaactgcacgttaaaggccgt
aacaactactggaaagtgcgtcaggctgtcgagacagcaaaagagacgctctacagtttc
gatcagttgaaaacgaataagagcgaaccgcgtcgtccgctgcgtaaaatggtgttcaac
gtgccgacccgccgtgaactgaccagcggtgagcgcgcgatccagcacggtcaggcgatt
gccgccgggataaaagcagcgaaagatctcggtaatatgccgccgaatatctgtaacgcc
gcttatctcgcctctcaggcgcgccagctggctgacagctacagcaagaatgtcatcacc
cgcgttatcggcgaacagcagatgaaagagctgggaatgcactcttatctggcggtcggt
cagggttcacaaaacgaatcgctgatgtcggtgattgagtacaaaggcaacgcgtcggaa
gatgcacgcccaatcgtgctggtgggtaaaggtttaaccttcgactccggcggtatctcc
atcaagccttcagaaggcatggatgagatgaagtacgatatgtgcggcgcggcggcagtt
tacggcgtgatgcgtatggtcgcggagctgcaactgccgattaacgttattggcgtgctg
gcaggctgtgaaaacatgcctggcgggcgtgcctatcgtccgggcgatgtgttaaccacc
atgtccggtcaaaccgttgaagtgctgaacaccgatgccgaaggccgcctggtactgtgc
gacgtgttaacttacgttgaacgttttgagccggaagcagtgattgacgtggcgacgctg
accggtgcctgcgtgatcgcgctgggtcatcatattactggtctgatgacgaaccataat
ccgctggcccatgaactgattgccgcgtctgaacaatccggtgaccgcgcatggcgctta
ccgctgggtgacgagtatcaggaacagctggagtccaattttgccgatatggcgaacatt
ggcggtcgtcctggtggggcgattaccgcaggttgcttcctgtcacgctttacccgtaag
tataactgggcgcacctggatattgcaggaaccgcctggcgttctggtaaagcaaaaggc
gcaaccggtcgtccggtagcgttgctggcacagttcctgttaaaccgcgctgggtttaac
ggcgaagagtaa

DBGET integrated database retrieval system