KEGG   Shigella flexneri 301 (serotype 2a): SF4229Help
Entry
SF4229            CDS       T00097                                 

Gene name
pepA
Definition
multifunctional aminopeptidase A
Orthology
K01255  
leucyl aminopeptidase [EC:3.4.11.1]
Organism
sfl  Shigella flexneri 301 (serotype 2a)
Pathway
Glutathione metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sfl00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4401645..4403156
Genome map
AA seq 503 aa AA seqDB search
MEFSVKSGSPEKQRSACIVVGVFEPRRLSPIAEQLDKISDGYISALLRRGELEGKPGQTL
LLHHVPNVLSERILLIGCGKERELDERQYKQVIQKTINTLNDTGSMEAVCFLTELHVKGR
NNYWKVRQAVETAKETLYSFDQLKTNKSEPRRPLRKMVFNVPTRRELTSGERAIQHGQAI
AAGIKAAKDLGNMPPNICNAAYLASQARQLADSYSKNVITRVIGEQQMKELGMHSYLAVG
QGSQNESLMSVIEYKGNASEDARPIVLVGKGLTFDSGGISIKPSEGMDEMKYDMCGAAAV
YGVMRMVAELQLPINVIGVLAGCENMPGGRAYRPGDVLTTMSGQTVEVLNTDAEGRLVLC
DVLTYVERFEPEAVIDVATLTGACVIALGHHITGLMTNHNPLAHELIAASEQSGDRAWRL
PLGDEYQEQLESNFADMANIGGRPGGAITAGCFLSRFTRKYNWAHLDIAGTAWRSGKAKG
ATGRPVALLAQFLLNRAGFNGEE
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggagtttagtgtaaaaagcggtagcccggagaaacagcggagtgcctgcatcgtcgtg
ggcgtcttcgaaccacgtcgcctttctccgattgcagaacagctcgataaaatcagcgat
gggtacatcagcgccctgctacgccggggcgaactggaaggaaaaccggggcagacattg
ttgctgcaccatgttccgaatgtactttccgagcgaattctccttattggttgcggcaaa
gaacgtgagctggatgagcgtcagtacaagcaggttattcagaaaaccattaatacgctg
aatgatactggctcgatggaagcggtctgctttctgactgaactgcacgttaaaggccgt
aacaactactggaaagtgcgtcaggctgtcgagacagcaaaagagacgctctacagtttc
gatcagttgaaaacgaataagagcgaaccgcgtcgtccgctgcgtaaaatggtgttcaac
gtgccgacccgccgtgaactgaccagcggtgagcgcgcgatccagcacggtcaggcgatt
gccgccgggataaaagcagcgaaagatctcggtaatatgccgccgaatatctgtaacgcc
gcttatctcgcctctcaggcgcgccagctggctgacagctacagcaagaatgtcatcacc
cgcgttatcggcgaacagcagatgaaagagctgggaatgcactcttatctggcggtcggt
cagggttcacaaaacgaatcgctgatgtcggtgattgagtacaaaggcaacgcgtcggaa
gatgcacgcccaatcgtgctggtgggtaaaggtttaaccttcgactccggcggtatctcc
atcaagccttcagaaggcatggatgagatgaagtacgatatgtgcggcgcggcggcagtt
tacggcgtgatgcgtatggtcgcggagctgcaactgccgattaacgttattggcgtgctg
gcaggctgtgaaaacatgcctggcgggcgtgcctatcgtccgggcgatgtgttaaccacc
atgtccggtcaaaccgttgaagtgctgaacaccgatgccgaaggccgcctggtactgtgc
gacgtgttaacttacgttgaacgttttgagccggaagcagtgattgacgtggcgacgctg
accggtgcctgcgtgatcgcgctgggtcatcatattactggtctgatgacgaaccataat
ccgctggcccatgaactgattgccgcgtctgaacaatccggtgaccgcgcatggcgctta
ccgctgggtgacgagtatcaggaacagctggagtccaattttgccgatatggcgaacatt
ggcggtcgtcctggtggggcgattaccgcaggttgcttcctgtcacgctttacccgtaag
tataactgggcgcacctggatattgcaggaaccgcctggcgttctggtaaagcaaaaggc
gcaaccggtcgtccggtagcgttgctggcacagttcctgttaaaccgcgctgggtttaac
ggcgaagagtaa

DBGET integrated database retrieval system