KEGG   Scleropages formosus (Asian bonytongue): 108918071Help
Entry
108918071         CDS       T04919                                 

Gene name
abhd12
Definition
(RefSeq) monoacylglycerol lipase ABHD12
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sfm  Scleropages formosus (Asian bonytongue)
Brite
Enzymes [BR:sfm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     108918071 (abhd12)
Peptidases [BR:sfm01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   108918071 (abhd12)
Exosome [BR:sfm04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   108918071 (abhd12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 391 aa AA seqDB search
MRKRNSSQPLDHDSAVTNTLLDSTPNLNPGAKSCRRKGKVVLDSAPLDAARKPMGRTSRR
YRLMPRLKKIFLWVLAVYIAIPFIVKLCPSIQAKLVFLNFVRVPYFIDLKRPQDQGLNHT
CNLYLHPEENVNIGVWHTVPAQLWKDAQGKDQLWYESTFQSSHPVILYLHGNAGTRGGDH
RVQLYKVLSSLGYHVVTFDYRGWGDSEGSPSESGMTSDALYVFHWVKERIGKKPLYIWGH
SLGTGVATNLVRHLCDRGTPPDALILESPFTNIREEARSHPFSMVYRYLPGFDWFFLDAI
TANDIRFASDENMHHISCPVLILHAEDDTVVPFHLGKKLYNIAAQSQSLSGQKVQFIPFP
ISLGYKHKFIYRSPELPQILSDFLGTVHPHA
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcggaacagctcccagcccctggaccatgacagcgccgtcaccaacacgctg
ctggactcgaccccgaacctgaaccctggcgcgaagagctgtcgtaggaaaggcaaagtg
gtgctcgactctgctcctctggatgctgctcggaagcccatggggaggacgtcgagaagg
tatcgcctgatgcccaggctgaagaagatcttcctgtgggttctggctgtctacattgcc
attcccttcatcgtaaagctgtgcccctccatccaggctaaactagtctttttaaacttt
gttcgtgtgccctacttcattgacctgaagagacctcaagaccagggcttgaaccacacc
tgtaacttgtacctacacccagaggagaatgtcaacattggcgtgtggcacacagtccca
gcccagctctggaaggatgcccaggggaaggaccagctgtggtacgagagcaccttccag
tcctcgcacccagtcatactgtacctacatggcaatgctgggaccaggggtggggaccac
agagtacagctctacaaggttctcagttcattaggctaccatgtagtgacatttgattac
agaggatggggcgactcggaaggcagcccttcagagagcggcatgacttcagatgccctt
tatgtcttccactgggtaaaggagaggattggaaagaagcccctgtatatctggggccac
tctttgggaacaggtgtggcgactaacctggttagacacctgtgtgacagagggacacca
ccggacgcgctgatcttggagtctccgttcacgaacatccgagaggaggctaggagtcat
cctttctcaatggtttacaggtatctgcctgggtttgactggttcttcctggatgctata
acggcaaacgatattcgatttgcaagtgatgaaaatatgcaccacatctcgtgcccagtg
ctcatcctccatgctgaagacgataccgtggtaccattccacctaggcaagaagctgtac
aacatcgctgcccagtcccagagcttgagtggccaaaaggtccagttcatcccctttccc
atcagccttggctacaagcacaagttcatctacaggagcccggagctaccacagatccta
agtgactttcttgggacagtccatccccacgcgtag

DBGET integrated database retrieval system