KEGG   Serratia fonticola: Z042_11185Help
Entry
Z042_11185        CDS       T02987                                 

Definition
phosphoenolpyruvate carboxylase (EC:4.1.1.31)
Orthology
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
sfo  Serratia fonticola
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:sfo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Z042_11185
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Z042_11185
  Energy metabolism
   00680 Methane metabolism
    Z042_11185
Enzymes [BR:sfo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Z042_11185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2475422..2478058
Genome map
AA seq 878 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGEHILDRVETIRKLSKSSRAGNEAHRQELLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHSISPNGEAASNPEALAQLFTRLKDQKLNNKE
LQNAVDELSIELVLTAHPTEITRRTLIHKLVEVNTCLSQLDHNDLADYERNKIMRRLRQL
VAQSWHTDEIRKYRPSPVDEAKWGFAVVENSLWEGVPAFLREFNEQLENSIDYRLPVEAV
PVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKACDLFTRDIQVLVSELSMSECTPELRE
LAGGDSVQEPYRELMKRLRSQLMSTQAYLEGRLKGERVLRPQDLLVNNEQLWEPLYACYQ
SLITCGMGIIANGQLLDTLRRVRCFGVPLVRIDVRQESTRHTEAIAELTRYLGLGDYESW
SEADKQAFLIRELNSKRPLVPLNWKPSDETQEVLETCRVIAEAPQGSIAAYVISMARTPS
DVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMTQLLNIDWYRGFIQGKQMVMIGY
SDSAKDAGVMAASWAQYRAQDALIKTCEKAGVALTLFHGRGGSIGRGGAPAHAALLSQPP
GSLKGGLRVTEQGEMIRFKFGLPEVTISSLALYAGAVLEANLLPPPEPKKEWRSLMDELS
ETSCKMYRGYVRENPDFVPYFRAATPEQELGKLPLGSRPAKRRPNGGVESLRAIPWIFAW
TQNRLMLPAWLGAGAGLQEAVKAGKQEQLGAMCRDWPFFSTRIAMLEMVFSKTDLWLAEY
YDQRLVDKSLWPLGKQLRDQLESDIKVVLAIANDDNLMEDLPWIAESIALRNVYTDPLNV
LQAELLHRSRQQEHPDARVEQALMVTIAGVAAGMRNTG
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattcggcaatgcgcagtaatgtcagtatgctcggcaaattgctcggc
gacaccatcaaagaagcactgggcgagcacattcttgatcgcgttgaaactattcgtaag
ctttccaaatcttcacgtgccggtaatgaagcacaccgtcaagaattgttatcgacgcta
cagaacctgtctaacgacgagttgctgccggtcgcacgcgccttcagccaattccttaat
ctgaccaacgtagctgaacaatatcacagcatttcgccaaacggcgaggcggcaagcaac
ccagaagcgttggcccagctgtttacccggctgaaagaccagaagctcaacaacaaagaa
ctccagaatgcggtagatgagctctctattgagctggtgctgacagcacatccgacggaa
atcacccgccgcacgttgatccataaattggttgaggtgaatacctgcctcagccagctc
gatcacaacgatctggctgactatgagcgcaataaaatcatgcgccgcctgcgccagtta
gtggcgcaatcctggcacaccgacgaaatccgcaaataccggccatcgcctgttgatgaa
gccaaatggggctttgccgtagtggaaaacagcctgtgggaaggcgtgcccgcattcctg
cgcgaatttaacgaacagctggaaaactccattgattaccgcctgccggtagaagcggtg
cctgtgcgtttcacctcctggatgggcggtgaccgcgacggtaacccgaacgtcacggca
gaaatcacccgtcatgtcctgttgctgagccgctggaaagcctgtgatctgttcactcgc
gatatacaggtgctggtttccgaactatcgatgtccgaatgtaccccggaactgcgtgaa
cttgccggtggcgatagcgtgcaggaaccctaccgcgaactgatgaaacgcctgcgcagc
caattgatgagcacccaagcttacctggaagggcggctgaaaggtgaacgcgttttacgc
ccacaggatctgctggttaataacgagcaattgtgggaaccgctgtatgcctgttatcaa
tcgctgataacctgtggcatggggattatcgctaacggccagttgctggatacgctgcgc
cgcgtgcgctgtttcggcgtgccgctggtacgtattgacgttcgccaggaaagcacccgc
cataccgaagccatcgccgaactaacccgctatttggggctgggtgattatgaaagctgg
tctgaagccgataaacaggccttcctgatccgcgaactgaactccaaacgcccactggtt
cccctgaactggaagccaagcgacgagactcaggaagtgctggaaacctgccgtgtgatc
gcagaagcgccacagggttccattgccgcctatgtgatttctatggcacgcactccatcc
gacgtactggcggtacatctgctgctgaaagaggccggttgcccattcgcgctgcccgtg
gcaccgctgttcgaaacccttgatgacttgaacaatgccgatgatgtgatgacccaattg
ctgaatatcgactggtatcgcggctttattcagggcaaacagatggtaatgatcggctat
tctgactcagcgaaagacgctggtgtgatggcggcttcctgggcgcagtaccgggcgcag
gacgcgctgatcaagacctgtgaaaaagccggcgtagcgctgacattgttccatggccgt
ggcggttcaattggccgtggtggcgcaccggcccatgcggctctgctgtcacagccaccg
ggcagcctgaaaggtggcctgcgtgtcaccgaacagggcgagatgatccgtttcaagttt
ggcctgccagaagtcaccatcagcagcctggcactgtacgctggggcggttttggaggcc
aatctgttgcctccgcctgaaccgaaaaaagaatggcgctcgctaatggatgaattgtct
gaaacctcatgcaaaatgtatcgcggctacgtgcgtgaaaacccggactttgtgccttat
ttccgcgcggcaaccccggaacaggagctaggtaagctgccattgggttcacgcccggcc
aagcgtcgcccgaatggtggcgtagaaagcctgcgagccattccgtggatcttcgcctgg
acgcaaaaccgcctgatgctcccagcttggctgggtgccggtgcgggcttgcaggaagcg
gtgaaagcgggcaaacaagaacagttgggagccatgtgccgtgactggccgttcttttcc
acccgcatcgcgatgttggagatggtgttctccaaaaccgacctgtggctggcagaatat
tacgatcagcggctggtagacaaatcgttgtggccgttaggtaagcaattacgcgatcag
ttggaaagcgatatcaaggtcgtgctggccatcgccaacgatgacaatctgatggaggat
ttaccgtggatcgccgaatccatcgcgttgcgtaacgtttataccgatccgctcaacgtt
ttacaggccgaactgttgcaccgttcacgccaacaggaacacccggatgcccgtgttgaa
caagctctgatggtgaccattgccggcgtcgccgccgggatgcgcaataccggttag

DBGET integrated database retrieval system