KEGG   Serratia fonticola: Z042_11775Help
Entry
Z042_11775        CDS       T02987                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sfo  Serratia fonticola
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sfo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Z042_11775
Enzymes [BR:sfo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Z042_11775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
complement(2598829..2599755)
Genome map
AA seq 308 aa AA seqDB search
METGKLVVLGSINADHILNIEQFPRPGETVIGKQYNVAFGGKGANQAVAAGRSGAEIAFI
ACVGADDIGERIRQQLATDGIDTQSIEAIAHRTTGVALIFVNAEGENVIGIDAGANAALT
PDYLNHHRQKVIDAEALLMQLESPIETVIAAAKLAKQHHTQVILNPAPARELPDELLAMI
DIITPNETEAQRLTGIAVNNDNDAARAANALHDKGIGCVIITLGSRGVWLSENGSGKRVP
GFKVKAVDTIAAGDTFNGALVTALLEGKAMNEAVRFAHAAAAIAVTRAGAQPSVPWRAEI
DAFLLQQG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaggaaagctggtggttctgggtagtattaatgccgaccatatcctcaatatc
gaacagtttccccgcccaggcgaaacggtgatcgggaagcagtataacgtcgctttcggt
ggcaaaggggctaaccaggctgtggctgccgggcgcagtggcgcggaaatcgcgtttatc
gcctgtgttggggctgatgatattggtgagcgtattcgccagcagctggcgaccgatggt
attgatactcaatcgattgaagctatcgcccaccgtactaccggtgttgcactgattttt
gttaatgcggaaggtgaaaacgtgattggtattgacgcaggcgcgaatgcagcgctgacg
cccgattacctcaatcaccatcggcagaaagtgatcgatgctgaggcgttactgatgcag
cttgaatcacccatcgaaacggtaattgctgccgccaaactggcaaaacagcaccatacg
caagtgatcctcaacccggcaccggctcgcgaattgccggatgaattactggcgatgatc
gatatcatcacgccgaatgaaaccgaagcgcagcggctgaccggtattgctgttaataac
gataatgatgctgctcgtgcagccaatgcgctgcatgataaaggtatcggatgcgtgatt
attacactcggcagccggggggtttggctgagtgaaaatggcagcggcaaacgagtgcct
ggctttaaggtgaaagcggtcgataccattgcggctggcgatacgttcaacggcgcactg
gttactgcgttactcgaaggtaaagcaatgaatgaagctgtgcgtttcgcccatgcagct
gcggcaattgccgtcactcgcgcgggtgcacaaccttcggtaccttggcgtgcagagatt
gacgccttcctgctgcaacaggggtaa

DBGET integrated database retrieval system