KEGG   Serratia fonticola: Z042_12320Help
Entry
Z042_12320        CDS       T02987                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sfo  Serratia fonticola
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Z042_12320
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Z042_12320
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Z042_12320
Enzymes [BR:sfo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Z042_12320
Exosome [BR:sfo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Z042_12320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
2725538..2727055
Genome map
AA seq 505 aa AA seqDB search
MVTRFVLSATLLTGLGTTASAEEKVQLVQQDNPYFKQAQGQLRQILAQPRNTNQAKNVIL
VVGDGMGFSTVTAARIFEGQQRGVDGESNVLAWEAFPYLAAAKTYSDNAQITDSAPSAVA
MTTGVKTINDLMGLDHTARLNNCEDQKTKAVTTLWEMAASVGMATGAVTTATVTHATPGA
TYAHIANRDWESDAKMPAEALSAGCHDIARQLVEMKYGNGLNVAMGGGRANFLPDSVIDP
EYPDKKGKRQDGRDLTAAWLKRYGERGSYIWNQAQFDKLDPAKVDHLLALFEPSHMQFEH
DRPRDAAGEPSLAEMTGKAIDILAKNPEGYLLLVEGGRIDHGSHDGNAYRTLTDAVALND
AVKTILNKVNLDETLVVVTGDHSHTLTISGYAKRGNPILGISVNVEGKTQLGSDGKPYTT
IGFANGPGGTIPLLERPALTMDQAKAPDFIQPALVPLKSETHGGEDLGIYAIGPWAHLFQ
GTVEENYTFHVMNYASRIGERLSTR
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggtcactcgctttgttttgtcggccacattattaacaggcttgggaaccaccgccagt
gcagaggaaaaagtgcaactggtgcaacaggataatccttattttaaacaggcacaggga
caattgcggcaaatattggctcaaccacgcaataccaaccaggccaaaaacgtcatcctg
gtggtgggggatggcatgggtttttctaccgttaccgcggcgcgtatttttgaaggacaa
cagcgcggtgttgacggtgaatccaacgtgctggcgtgggaggcatttccctatctggct
gccgccaaaacctactctgacaacgcccagattaccgattccgcccccagtgccgttgcc
atgactaccggcgtcaaaaccatcaacgatctgatggggctggatcatacggcacggctc
aacaattgtgaggatcagaaaaccaaggctgtcaccaccttatgggaaatggccgcgtcc
gttggcatggcgaccggtgctgttaccaccgccacggttacccatgcgacaccgggcgca
acttacgcccatattgccaaccgtgattgggaatctgatgccaaaatgcctgctgaagcg
ttgtcggcaggctgccatgatattgctcgccaactggtagagatgaagtacggcaatggc
cttaacgttgctatgggtggcggccgcgccaactttttacccgacagcgtcattgatcca
gaatatcccgataaaaaaggtaaaaggcaggatggccgcgatctgacggcagcctggctt
aaacgttatggtgagcgtggcagctacatctggaatcaggcacagtttgataagcttgat
cctgccaaggttgatcatttactggccttgtttgaaccttcacatatgcagttcgaacat
gatcggccgagggatgcggcaggtgaaccctcgttggcggaaatgacagggaaagccatt
gatattctggctaaaaaccccgaaggttacctgttgctggtggaaggcgggcgcattgat
catggtagccatgatggtaatgcctatcgtaccctgacggatgccgtggcccttaatgac
gcggtgaaaactatccttaataaggtcaatcttgacgaaacgctggtggtggtcactggt
gaccacagtcatacgctcactatttccggttatgccaaacggggtaatccaatccttggt
atttccgttaacgttgagggtaaaactcagttaggcagcgacggtaaaccctataccacc
atcggttttgctaatggccctggtggcacgatccccttgctggaacgccccgctctcact
atggatcaggccaaagcgcctgactttatccaacccgcgctggtgccgctgaagagtgaa
acccatggcggtgaggatttgggcatctacgcgattggtccttgggcgcatctgttccag
ggcacggttgaagagaattacaccttccatgtgatgaactacgccagccgcatcggtgaa
cgcctgtcaacccggtaa

DBGET integrated database retrieval system