KEGG   Serratia fonticola: Z042_23135Help
Entry
Z042_23135        CDS       T02987                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sfo  Serratia fonticola
Brite
Enzymes [BR:sfo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Z042_23135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
Position
5040443..5040985
Genome map
AA seq 180 aa AA seqDB search
MTIKNKIVTAICSVSAIIGLIEAEEYISANDNHLRFSKAAMEVMGNAEGCRREPYLCPAN
IMTQGIGHTGKGVAVVNKASDKQIARWFAEDQLGAQNCIEINVERKLGKKIPQGAFDGIG
SFIFNVGCPQFTSSTMYRYLLNGKIVAACEQLPRWIYAGKTILPGLVARREKEKALCLSR
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgacgattaagaataaaatcgttaccgccatctgttcggtgtctgcaattattgggctt
atagaggcagaggaatatatttctgcaaacgataaccatctccgattttcaaaagctgca
atggaggttatggggaatgccgaagggtgccggcgcgaaccatatctttgcccagcgaat
attatgacgcagggtatcggacatacaggaaaaggggtggctgttgtcaacaaagccagc
gacaagcagatagcccgttggtttgctgaggatcaattgggtgctcagaattgcattgaa
attaatgttgagcgaaagctgggaaaaaaaatccctcaaggtgcattcgatgggatcggg
agctttatttttaacgtggggtgtcctcagtttacatcgtccacgatgtaccgctatctg
ctgaacggcaaaatcgtagccgcttgtgaacaattaccacgctggatttatgccggaaaa
actattctcccagggctagtagcccgaagagagaaagagaaagcactctgtctatctcgc
tga

DBGET integrated database retrieval system