KEGG   Shewanella frigidimarina: Sfri_0123Help
Entry
Sfri_0123         CDS       T00395                                 

Definition
(GenBank) Delta-9 acyl-phospholipid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr01040  Biosynthesis of unsaturated fatty acids
sfr01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sfri_0123
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sfri_0123
Lipid biosynthesis proteins [BR:sfr01004]
 Desaturase
  First
   Sfri_0123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase HAUS2
Motif
Other DBs
NCBI-ProteinID: ABI69986
JGI: Sfri0123
UniProt: Q089S9
Position
complement(136557..137666)
Genome map
AA seq 369 aa AA seqDB search
MKKPPIIWLNTLLFAITFIGAVVLIPWRGFTHGFDGIEWIAFVVFAYASGLSITAGYHRL
WSHKAYKAHASVRFLYALGGALALQNSALHWCSDHRIHHKHVDNNDKDPYSAQMGFWYSH
IGWMLREYQASRYSDYNNVRDLQNDRIVMWQHKHYLALVILMNIGLPAFIGWLNGDILSM
VLMAGLLRLVVVHHCTFFINSLAHIWGKQPYTDKNSARDNAFLALLTYGEGYHNFHHIFE
NDYRNGIKWWDYDPTKWLIKLMNWFGLASDLRKVPQERIESARLQMQLLQAQNQVAHLPN
CDEIIEKFQAEYELMKQHLVDYYQAKKSLLEAKRKQLTDHNLKQQVQLLRNQFLEQQRNW
KSLTGAYAQ
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacctccaatcatttggcttaataccttgttatttgccattacttttatcggc
gccgtggtattaatcccttggcgtggttttacccatggctttgatggcattgaatggatt
gcatttgttgttttcgcttacgcaagtggtctatcgattactgcgggttaccacagatta
tggtcacacaaagcttataaagcccatgcatcagttcgttttttatacgcattaggtgga
gcattggcgctacagaacagcgcattgcattggtgtagtgatcaccgcatccatcacaaa
catgttgataataatgataaagacccgtactcagctcaaatgggattttggtacagccac
ataggttggatgctacgtgagtatcaagcgagtcgttacagcgactacaacaacgtgcgc
gacttacaaaacgatcgtatcgttatgtggcagcacaagcactacttagccttagtgatc
ttaatgaatattggtttaccagcatttataggttggttaaatggcgatattttatcaatg
gttcttatggccggtttactacgcctagtggttgtacatcactgtactttctttattaac
tcattagcccatatttggggtaaacaaccgtacacagataaaaactcagcccgagataat
gcatttttagcgttacttacatacggtgaggggtatcacaacttccatcatatttttgaa
aatgattatcgcaatggcatcaaatggtgggactacgatccaaccaaatggttaatcaag
cttatgaactggtttggtttagcgagtgatttacgtaaagtgccacaagagcgtattgaa
agtgcacgtttgcagatgcaacttttacaagctcagaatcaggttgctcacttacctaac
tgcgatgaaattatagaaaagtttcaagcagagtatgagctgatgaagcaacacttagtt
gactattatcaagccaaaaagagtttgttagaggcgaagcgtaagcaacttacagatcac
aatctgaagcaacaagtgcaattattacgtaatcagtttcttgaacaacaacgaaattgg
aaaagcctcacaggtgcctacgcccagtaa

DBGET integrated database retrieval system