KEGG   Shewanella frigidimarina: Sfri_0195Help
Entry
Sfri_0195         CDS       T00395                                 

Definition
argininosuccinate lyase (EC:4.3.2.1)
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfri_0195
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sfri_0195
   00330 Arginine and proline metabolism
    Sfri_0195
Enzymes [BR:sfr01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Sfri_0195
Exosome [BR:sfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sfri_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
214516..215946
Genome map
AA seq 476 aa AA seqDB search
MTYSYIIKHPVLKTVFKTEDTDMALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSI
AWADAIASVGIITAKECTDLKAALNELLVEVGNDPQAIISNGAEDIHSFVEQKLIAKVGD
LGKKLHTGRSRNDQVATDLKLWCKKEGAALLARLGTLHAELIALAEREVDAVMPGYTHLQ
RAQPVTFGHWALAYVEMYERDISRLQDALNRADSCPLGSGALAGTAYPIDRHALAAALNF
ARPTLNSLDSVSDRDHVVELCSAASISMMHLSRMAEDLIFFNSGEANFISLADEVTSGSS
LMPQKKNPDALELIRGKTGRVYGSLMGILTTMKALPLAYNKDMQEDKEGLFDVVDSWAIC
LDMAALVLSGLKVNRPQALVAAQQGYANATELADYLVAKGMPFREAHHVVGEVVVFAIGE
QKPIEDLSVAELQKFANVISDDVYPNLTIEACLEKRDVLGGTAINQVQAVIAAKKA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacttacagctatattattaaacacccagttcttaaaacagttttcaaaacagaggat
accgacatggcgttatggggcggaagatttcagggcgaaaccagtgcacttttcaagtta
tttaatgactcactgccagtggattaccgcttatttgaacaagatgtagtcggttctatc
gcatgggcagacgccattgctagcgtcggtattattactgccaaagaatgtactgatcta
aaagcagcattaaacgaattgctggtggaagtaggtaacgatcctcaagctattattagc
aacggcgctgaagatattcacagctttgttgaacaaaagctgattgccaaagtgggcgat
ttaggtaaaaaactccacacgggccgttcacgtaacgaccaagtcgccacagatttaaaa
ctgtggtgcaaaaaagaaggcgctgcattacttgcgcgtttaggtacattacatgcagag
ttgattgcattagccgagcgtgaagttgacgcagtgatgccggggtacacccatttacag
cgtgctcagccggttacatttggtcactgggcgttagcctatgtagaaatgtacgagcgt
gacattagccgcctgcaagatgctctaaaccgtgccgattcatgtccattaggttctggc
gcactcgctggtactgcttatccgattgatcgccacgcgttagcggcggcattaaacttt
gctcgcccaaccttaaacagcttagacagtgtgtcggatcgcgaccatgtggttgaatta
tgcagcgcagcgtcaatcagcatgatgcatttaagccgcatggctgaagatttaatcttc
ttcaactctggcgaagctaactttatctcactagccgatgaagtcacctctggctcatct
ttaatgccacaaaagaaaaaccctgatgctttagagcttattcgtggtaaaaccggccgt
gtttatggcagcttaatgggtattttaaccaccatgaaagccttgccattagcgtacaac
aaagacatgcaagaagacaaagaaggcttgtttgacgtagtcgacagctgggctatttgc
ttagacatggcagcattagtattgtcgggcttaaaagtgaatcgtccacaagccttggtt
gcagctcagcaaggttatgctaacgcaactgaacttgcagattatcttgtggctaaaggc
atgccgttccgtgaagcacatcatgtagtgggcgaggtggtggtatttgccattggtgag
caaaagccgattgaagacttaagcgtggctgagctacaaaaatttgccaatgtgattagc
gatgatgtgtatccaaaccttacgattgaagcgtgtttagaaaaacgtgatgtattaggt
ggcaccgccatcaatcaagtgcaagcggttatcgcggctaaaaaagcatag

DBGET integrated database retrieval system