KEGG   Shewanella frigidimarina: Sfri_0195Help
Entry
Sfri_0195         CDS       T00395                                 

Definition
argininosuccinate lyase (EC:4.3.2.1)
Orthology
K01755  
argininosuccinate lyase [EC:4.3.2.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sfr01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sfr00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sfr00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
214516..215946
Genome map
AA seq 476 aa AA seqDB search
MTYSYIIKHPVLKTVFKTEDTDMALWGGRFQGETSALFKLFNDSLPVDYRLFEQDVVGSI
AWADAIASVGIITAKECTDLKAALNELLVEVGNDPQAIISNGAEDIHSFVEQKLIAKVGD
LGKKLHTGRSRNDQVATDLKLWCKKEGAALLARLGTLHAELIALAEREVDAVMPGYTHLQ
RAQPVTFGHWALAYVEMYERDISRLQDALNRADSCPLGSGALAGTAYPIDRHALAAALNF
ARPTLNSLDSVSDRDHVVELCSAASISMMHLSRMAEDLIFFNSGEANFISLADEVTSGSS
LMPQKKNPDALELIRGKTGRVYGSLMGILTTMKALPLAYNKDMQEDKEGLFDVVDSWAIC
LDMAALVLSGLKVNRPQALVAAQQGYANATELADYLVAKGMPFREAHHVVGEVVVFAIGE
QKPIEDLSVAELQKFANVISDDVYPNLTIEACLEKRDVLGGTAINQVQAVIAAKKA
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacttacagctatattattaaacacccagttcttaaaacagttttcaaaacagaggat
accgacatggcgttatggggcggaagatttcagggcgaaaccagtgcacttttcaagtta
tttaatgactcactgccagtggattaccgcttatttgaacaagatgtagtcggttctatc
gcatgggcagacgccattgctagcgtcggtattattactgccaaagaatgtactgatcta
aaagcagcattaaacgaattgctggtggaagtaggtaacgatcctcaagctattattagc
aacggcgctgaagatattcacagctttgttgaacaaaagctgattgccaaagtgggcgat
ttaggtaaaaaactccacacgggccgttcacgtaacgaccaagtcgccacagatttaaaa
ctgtggtgcaaaaaagaaggcgctgcattacttgcgcgtttaggtacattacatgcagag
ttgattgcattagccgagcgtgaagttgacgcagtgatgccggggtacacccatttacag
cgtgctcagccggttacatttggtcactgggcgttagcctatgtagaaatgtacgagcgt
gacattagccgcctgcaagatgctctaaaccgtgccgattcatgtccattaggttctggc
gcactcgctggtactgcttatccgattgatcgccacgcgttagcggcggcattaaacttt
gctcgcccaaccttaaacagcttagacagtgtgtcggatcgcgaccatgtggttgaatta
tgcagcgcagcgtcaatcagcatgatgcatttaagccgcatggctgaagatttaatcttc
ttcaactctggcgaagctaactttatctcactagccgatgaagtcacctctggctcatct
ttaatgccacaaaagaaaaaccctgatgctttagagcttattcgtggtaaaaccggccgt
gtttatggcagcttaatgggtattttaaccaccatgaaagccttgccattagcgtacaac
aaagacatgcaagaagacaaagaaggcttgtttgacgtagtcgacagctgggctatttgc
ttagacatggcagcattagtattgtcgggcttaaaagtgaatcgtccacaagccttggtt
gcagctcagcaaggttatgctaacgcaactgaacttgcagattatcttgtggctaaaggc
atgccgttccgtgaagcacatcatgtagtgggcgaggtggtggtatttgccattggtgag
caaaagccgattgaagacttaagcgtggctgagctacaaaaatttgccaatgtgattagc
gatgatgtgtatccaaaccttacgattgaagcgtgtttagaaaaacgtgatgtattaggt
ggcaccgccatcaatcaagtgcaagcggttatcgcggctaaaaaagcatag

DBGET integrated database retrieval system