KEGG   Shewanella frigidimarina: Sfri_0664Help
Entry
Sfri_0664         CDS       T00395                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sfr  Shewanella frigidimarina
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
774487..775242
Genome map
AA seq 251 aa AA seqDB search
MNPCNIGITMKLTKAFALVASLIIAPIVSAATATDVSNESALKQKLTETLGVNVMLIQQS
PVDGLYQALTDRGVLYVTKDGAKLFHGNLYDMDKGMKNLTEAALAGPRIELLKPFEDEML
VYKAKNEKHVVTIFTDVDCGYCRKLHNQMQGYNDLGITIRYLAYPRAGIPSANADEMQAV
WCAKDPLKAMTEAKNGGNVKAASCDIDIAAQYKLGMSFGVNGTPALILENGVMVPGYQAP
ADLLRTIESNL
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtgtaatataggaattaccatgaagttaactaaagcattcgcccttgttgcc
agccttattattgcccctattgtgtcagcggcaactgcgaccgatgtatccaatgaatca
gcattaaagcaaaaactcactgaaaccttaggggtcaacgtgatgctcattcaacaatct
ccagtcgatggtttatatcaagcactaacagaccgcggagtcctatacgtcaccaaagat
ggcgcaaagctatttcatggcaatctgtatgacatggataaaggcatgaaaaacttaact
gaggcagctttagctggacctcgtattgagttacttaagccgtttgaagatgagatgttg
gtttacaaagcgaaaaacgaaaagcatgtggtcacaatatttaccgacgtagattgtggt
tattgccgtaagctgcataatcaaatgcaaggctataatgatttaggtattacgattcgt
tatttagcttatcctcgtgcgggcattccatctgctaatgcagacgagatgcaagcggta
tggtgtgctaaagatcctttaaaagcgatgacagaagctaaaaatggtggcaatgttaaa
gcggctagttgtgatattgatattgcagcgcagtataagttaggtatgtcattcggtgtt
aacggcacaccagcgttgattttagaaaatggtgtgatggtacctggttatcaagctccg
gcagacttattacgtacgattgaatcgaatttataa

DBGET integrated database retrieval system