KEGG   Shewanella frigidimarina: Sfri_0917Help
Entry
Sfri_0917         CDS       T00395                                 

Definition
(GenBank) DNA polymerase III chi subunit, HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00230  Purine metabolism
sfr00240  Pyrimidine metabolism
sfr01100  Metabolic pathways
sfr03030  DNA replication
sfr03430  Mismatch repair
sfr03440  Homologous recombination
Module
sfr_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sfri_0917
   00240 Pyrimidine metabolism
    Sfri_0917
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Sfri_0917
   03430 Mismatch repair
    Sfri_0917
   03440 Homologous recombination
    Sfri_0917
Enzymes [BR:sfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Sfri_0917
DNA replication proteins [BR:sfr03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Sfri_0917
DNA repair and recombination proteins [BR:sfr03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Sfri_0917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi PQQ
Motif
Other DBs
NCBI-ProteinID: ABI70770
JGI: Sfri0917
UniProt: Q086P5
Position
complement(1081379..1081828)
Genome map
AA seq 149 aa AA seqDB search
MTQALFYLMPDNHNQMSALDALYLAACRLAEQQYRQQKTVYIHCKDKQQAYAIDELLWQF
EPNAFVPHNLKGEGPVTGAPVEIGFDTLGPNKSRQVLINLADQMPSFAVNLPHIIDFVAN
DDELKRIARNRYRQYQNVGITPSTQALAE
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagccttgttttaccttatgcctgataatcataatcaaatgagtgcattagat
gcgctctatttagctgcttgcaggttagctgaacaacaatatcgccaacaaaaaaccgtc
tacattcactgcaaagacaaacagcaagcttatgcaattgacgaattactgtggcaattt
gagcccaacgcctttgttccacacaatttaaaaggtgaaggcccagtgacaggtgcaccg
gtcgaaattggttttgatactttaggaccaaataaaagtcgtcaagttctgattaatctt
gcagaccaaatgcccagttttgcggtaaacttgccccatattatcgattttgtcgctaat
gatgacgaactcaagcgcattgctcgcaatcgctaccgtcaatatcagaatgtaggcatt
acgcccagcactcaagcattagctgaataa

DBGET integrated database retrieval system