KEGG   Shewanella frigidimarina: Sfri_0984Help
Entry
Sfri_0984         CDS       T00395                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sfr  Shewanella frigidimarina
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfr00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1149915..1150778
Genome map
AA seq 287 aa AA seqDB search
MFLIYCRKIPLFQLTHANKTLDLSAPVVMGIVNVTPDSFSDGGEYIDFEQACRHVDYMVE
QGALIIDVGGESTRPGAAEVSVEQELARVIPIIEYTAKTHDVWISIDTSKPEVMEQAVNA
GANLINDVRALQMPGALAMAATLDVPICLMHMQGEPKTMQDEPEYQDVIDEVAAFFELRI
AYCEAAGIERERLILDPGFGFGKTLAHNYRLLAALPKLHEFHLPLLVGLSRKSMIGDLLA
RETDQRLAGSLAGALIAAQQGAHIIRVHDVPETVDVLKVMSETMAYL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaatctactgtaggaaaataccattgtttcaattaactcatgccaataaaacg
ctcgacttatcagcccctgttgtgatgggaattgtaaacgtgacacctgattctttttct
gatggtggcgaatacatcgatttcgaacaagcttgccgacatgttgattatatggtcgaa
caaggtgcattaattattgatgtcggtggtgagtcaactcgcccaggggctgcagaggtc
tctgttgagcaggagcttgctcgggttattcctattatcgaatataccgctaaaacacac
gacgtatggatttcaatcgataccagcaaacctgaagtgatggaacaagctgtcaatgct
ggagctaatttgattaatgatgtgcgtgccttacaaatgccaggagccttagcgatggct
gcgacgttagatgtgccgatttgcttgatgcacatgcaaggcgagcccaaaactatgcaa
gatgaacctgagtatcaagatgtgattgatgaggtggctgctttctttgaattgcgtatt
gcatactgcgaagccgccggaattgagcgcgaacgcttaattcttgatccaggttttggc
tttggcaaaactttagcgcataattaccgcctattagcggcgttacccaaattacatgaa
tttcacttacctttattggtcggtttatcacgtaaaagcatgattggtgacctgttagca
cgcgaaacagatcagcgtcttgcgggtagtctcgctggggcattgattgctgctcagcaa
ggtgcacatattattcgagtccatgatgtacccgaaactgtcgatgtactcaaagtgatg
tcagaaacaatggcctacttgtag

DBGET integrated database retrieval system