KEGG   Shewanella frigidimarina: Sfri_0986Help
Entry
Sfri_0986         CDS       T00395                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00010  Glycolysis / Gluconeogenesis
sfr00051  Fructose and mannose metabolism
sfr00562  Inositol phosphate metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
sfr01230  Biosynthesis of amino acids
Module
sfr_M00002  Glycolysis, core module involving three-carbon compounds
sfr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfri_0986
   00051 Fructose and mannose metabolism
    Sfri_0986
   00562 Inositol phosphate metabolism
    Sfri_0986
Enzymes [BR:sfr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sfri_0986
Exosome [BR:sfr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sfri_0986
  Exosomal proteins of bladder cancer cells
   Sfri_0986
  Exosomal proteins of melanoma cells
   Sfri_0986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABI70839
JGI: Sfri0986
UniProt: Q086H6
Position
1152310..1153092
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGNSALAEELFKKFATKLQNDSAEVVLCPPSIYLESVRQLLEANKQ
TLDGALVRMGAQNLSQHDFGAYTGEISGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKYGLTPILCVGESGPAREARRTFEVIAEELDIVIEKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRSRLSEVSPFIGENIRILYGGSVTPSNAADIFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtcgctggcaactggaaaatgaatggtaattcagcacta
gcagaagaattatttaagaagtttgctacaaagctccaaaatgattccgctgaagtggtt
ttatgcccgccttcaatttatcttgaaagtgttaggcagctgcttgaagccaataagcaa
accttagacggtgcgcttgttagaatgggtgctcaaaatcttagtcaacatgattttggt
gcatataccggcgaaatatccgggcagatgctaaaagattctggatgtcgatatgttatt
atcggccattccgaacgtcgccgtatgtacggagagacgagtaatatcgtggcagagaag
tttgccgcagcacaaaaatatggtctgacaccgattttatgcgtaggtgaatcaggacca
gctcgtgaagcaagacgtacctttgaggtgattgcggaagagcttgatatagtaattgaa
aaaaacggtaccatggcttttgataacgcaattatcgcctacgaacctttatgggctgta
gggacaggtaaaagcgcaacaccagagcaggcacaagaagtacatgcgtttattcgcagt
cgcctctctgaagtgtctccctttattggtgagaatatcagaattctatacggtggtagc
gtcaccccaagcaatgcggcagatatctttgcccagcctgatgttgatggtggtctgatt
ggcggtgcaagtttgaactcaagtgagtttttaagtttatgtaccatagcaatgagcgcg
taa

DBGET integrated database retrieval system