KEGG   Shewanella frigidimarina: Sfri_1003Help
Entry
Sfri_1003         CDS       T00395                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sfr  Shewanella frigidimarina
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sfri_1003 (deoA)
Enzymes [BR:sfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sfri_1003 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1173712..1175043
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGDVLSTAEIQFFVDGITHNTVSEGQIAAFGMAVYFKDMNMDERIALT
IAMRDSGTVLNWDSLGLNGPIIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKDAGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLAAGLDALAMDVKVGSGAFMPTYEASEELARSITAVANGAGTKTTALLT
DMNQVLASCAGNAVEVREAINFLTGQYRNPRLYAVTMGLCAEMLILGGIAQNEAEARHKL
NTVLDNGKAAEAFAKMVSGLGGPTDFVEAYDKYLPHAKIVRPVYANTSGFAYKMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGQEVNKDVPLAMIHAQSEDAFAEAAAAIQQA
IIIGDSAPEKTPEIYRYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagctcaagaaattattcgtaaaaaacgtaatggcgatgtattaagcactgca
gaaattcaattctttgttgatggcattactcataacacggtttcagaaggccaaattgct
gcgttcggcatggcagtgtatttcaaagatatgaatatggatgaacggattgcattaacg
attgcgatgcgtgattccggaaccgtattaaattgggattctctgggcctcaatggcccg
attatcgataagcatagcactggtggtgttggcgatgtaatcagcctaatgcttggccct
atggctgcagcttgtggcggttatgtgccaatgatttcaggtcgtggcttaggtcacacc
ggtggtacgttagataaatttgatgccattcctggttatcaaactgagccttcaagtgaa
ttattccgcaaagtggttaaagacgctggtgttgccattattggtcaaaccggtgactta
gtccctgctgataagcgtttctattcgattcgtgataataccgccaccgttgaatctatt
tcgttaatcaccgcatctattttatctaaaaagttagccgcggggcttgatgctctagca
atggatgtcaaagtcggcagcggtgcatttatgccaacttatgaagcatctgaagaatta
gctcgcagtattactgctgttgctaatggcgcaggaactaaaacaacggcattgttaact
gacatgaaccaagtattggcttcgtgtgcaggtaatgcggttgaggttcgtgaggcgata
aactttttgactggtcaatatcgtaatccacgtttatatgctgtcaccatgggattatgt
gcagaaatgctaattttgggtggtattgcacagaatgaagctgaagctcgtcataaacta
aatactgtattagataatggtaaagcagcagaggcttttgctaaaatggtatctggctta
ggtggcccaacagactttgttgaggcatatgataagtatttacctcatgcgaaaattgta
cgacctgtatatgccaacacatctggctttgcttacaaaatggatacacgagaacttggt
ttagccgtagtgaccttaggtggtggacgtcgcaaaccaggtgatgcactggattacagt
gttggattaactcaagtatgcgcattgggtcaggaagttaacaaagacgttccgttagcg
atgatccatgctcaatctgaagatgctttcgccgaagctgccgctgctattcagcaagcc
attattattggtgatagcgcgcctgagaaaacgcctgaaatatatcgttatattcgcgct
tcagatttataa

DBGET integrated database retrieval system