KEGG   Shewanella frigidimarina: Sfri_1058Help
Entry
Sfri_1058         CDS       T00395                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sfr  Shewanella frigidimarina
Brite
Enzymes [BR:sfr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Sfri_1058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1244993..1245628
Genome map
AA seq 211 aa AA seqDB search
MTRVASTSAMNLAKKLAEAGIRHPAVLHAVATTPRELFLDGALAHKAYENTALPIGQGQT
ISQPYIVARMTELLLQHNPQKVLEIGTGSGYQAAVLASLIPELFTIERIKALQIQARQRL
KRLDLHNVAFKYGDGWQGWSNRGPFDGIMVTAAAATVPQALLEQLSEHGVLIIPVGEDTQ
QLLKITRIGQTFQSEIIEAVKFVPLINGDLA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgacacgcgtagcttctacatcagcaatgaatttagccaaaaaattggccgaagcaggg
atccgacatcctgcggtattgcatgctgtagcaacaacaccacgtgaattgttccttgat
ggtgcattagctcataaagcgtatgagaatactgcattacctatcggacagggacagaca
atttcgcagccttatattgtggctcgaatgactgaactgctgctgcagcacaatcctcaa
aaagtgttagagattggcactggctcaggttaccaagcagctgttttagcatcgctaatt
cctgagcttttcacaattgagcgtataaaagcattacaaatacaagctcgtcaaagatta
aaacgtctagatttacacaatgtcgcattcaaatatggtgatggttggcaagggtggtca
aaccgtggaccatttgatggaataatggtgacagctgcagctgcaacagtacctcaagca
ttgcttgaacaattgtccgagcatggcgtattgattattccggtaggagaagacacccag
caattactcaaaattacccgtatcggacagacattccaatctgagattatagaggctgtt
aaatttgtacctcttattaatggagatttggcttag

DBGET integrated database retrieval system