KEGG   Shewanella frigidimarina: Sfri_1101Help
Entry
Sfri_1101         CDS       T00395                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sfr  Shewanella frigidimarina
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfri_1101
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfri_1101
   00630 Glyoxylate and dicarboxylate metabolism
    Sfri_1101
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sfri_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1300467..1302119
Genome map
AA seq 550 aa AA seqDB search
MTAEQLVAQYSKSTASRDDSVKTDLTFIGPTVNGQEEVFNSGAVAFLDSLCAKFVDEVPE
LLAKRKQKQARIDNGELPDFLPETRAIRDGNWTIRGMPEDLTDRRVEITGPVDRKMIINA
LNANVKVFMADFEDSLAPSWQKIVEGQINLRDAVRGDIELTVPETGKHYSLNPDPAVLIA
RVRGLHLIEKHIEYKGKPIPGGLVDFAMYFYHNYRQLLAKKSGPYFYIPKLESHIEARWW
AKMFAFVEERFCLQPGTIKCTCLIETLPAVFEMEEILYELRSNIVALNCGRWDYIFSYIK
TLKNYPDRVLPDRQAVTMDTKFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDEATNELV
LQKVRGDKELEARNGHDGTWVAHPGLADTAMKIFNDYIGGDRTNQLHITRDVDAPILASE
LLEPCQGERTEAGMRLNIRIALQYIEAWIQGNGCVPIYGLMEDAATAEISRTSIWQWIQH
GKSLSNGKLVTKALFKDMLKEETANVKKELGAERFNAGEFAKAAELFEQITTSDELVDFL
TLPGYELLTA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagaacaattagtagctcaatacagtaagtccacagcaagtcgtgatgattcg
gttaaaactgatctcacgtttattgggcctactgttaatggccaagaagaagtttttaac
tctggtgccgtggctttccttgattcgttatgtgcaaaatttgttgatgaagtacccgag
ctattagctaagcgtaagcaaaaacaagcccgtattgataatggtgagttacctgatttt
ttacctgaaactcgtgcaattcgtgatggtaattggactatccgtggaatgcctgaagat
ctcactgatagacgtgttgaaattaccggccctgttgatcgtaagatgatcatcaatgct
ttaaacgctaatgtaaaagtgtttatggccgactttgaggattcattagcaccgagttgg
caaaaaattgtcgaaggacaaattaaccttcgtgatgccgtgcgcggtgatattgaacta
actgtccctgaaacaggtaagcattattcgttaaatccggatcctgcagtgttaattgct
cgtgtacgtggtttgcatcttattgaaaagcacattgaatacaaaggcaaacccattcct
ggcggcttagtcgattttgctatgtacttttaccataattatcgtcaacttttagctaaa
aaatctggaccttacttttatattcctaagttagaaagccatatagaagcgcgttggtgg
gcgaaaatgtttgcctttgtagaagaacgtttttgcttacagcctggcaccattaaatgt
acttgtttaattgaaacattacctgcggtatttgaaatggaggagattctttatgaactt
cgttcaaacattgtcgcgctgaattgtggccgttgggattatatcttcagctacatcaaa
accttaaagaactatcctgatcgtgtgctacccgaccgtcaagcggtaactatggatact
aaatttttaagtgcctattcacgcttattgattaaaacttgccataaacgtggcgcatta
gccatgggcggaatggcagcatttattcctgccaaagatgaagcaactaacgaactggta
ttacaaaaagtacgtggcgataaggagttagaagctcgcaatggtcatgatggtacttgg
gttgctcatccgggtttagccgacacagcgatgaaaattttcaatgattacatcggtggc
gatagaaccaatcaattacacattactcgtgatgtcgatgcacccattttagccagcgaa
ttactcgagccttgtcaaggcgagcgaactgaagcgggtatgcggttgaacattcgtatt
gcgttgcagtacatcgaagcgtggatccagggcaatggttgcgtaccgatttacggtttg
atggaagatgctgccacagcagaaatatcgcgtacttctatttggcaatggatccagcat
ggtaaaagtttatccaatggcaaactggtcactaaagcattgtttaaagacatgttgaaa
gaggaaacggccaacgtgaaaaaggaacttggcgcggagcgttttaatgcaggtgagttc
gccaaagcggcagaattatttgaacaaattactacctctgatgagctagtcgatttctta
acattaccaggatatgaactgttaacggcgtaa

DBGET integrated database retrieval system