KEGG   Shewanella frigidimarina: Sfri_1101Help
Entry
Sfri_1101         CDS       T00395                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00620  Pyruvate metabolism
sfr00630  Glyoxylate and dicarboxylate metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01200  Carbon metabolism
Module
sfr_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfri_1101
   00630 Glyoxylate and dicarboxylate metabolism
    Sfri_1101
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sfri_1101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI DUF658
Motif
Other DBs
NCBI-ProteinID: ABI70954
JGI: Sfri1101
UniProt: Q085W1
Position
1300467..1302119
Genome map
AA seq 550 aa AA seqDB search
MTAEQLVAQYSKSTASRDDSVKTDLTFIGPTVNGQEEVFNSGAVAFLDSLCAKFVDEVPE
LLAKRKQKQARIDNGELPDFLPETRAIRDGNWTIRGMPEDLTDRRVEITGPVDRKMIINA
LNANVKVFMADFEDSLAPSWQKIVEGQINLRDAVRGDIELTVPETGKHYSLNPDPAVLIA
RVRGLHLIEKHIEYKGKPIPGGLVDFAMYFYHNYRQLLAKKSGPYFYIPKLESHIEARWW
AKMFAFVEERFCLQPGTIKCTCLIETLPAVFEMEEILYELRSNIVALNCGRWDYIFSYIK
TLKNYPDRVLPDRQAVTMDTKFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDEATNELV
LQKVRGDKELEARNGHDGTWVAHPGLADTAMKIFNDYIGGDRTNQLHITRDVDAPILASE
LLEPCQGERTEAGMRLNIRIALQYIEAWIQGNGCVPIYGLMEDAATAEISRTSIWQWIQH
GKSLSNGKLVTKALFKDMLKEETANVKKELGAERFNAGEFAKAAELFEQITTSDELVDFL
TLPGYELLTA
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacggcagaacaattagtagctcaatacagtaagtccacagcaagtcgtgatgattcg
gttaaaactgatctcacgtttattgggcctactgttaatggccaagaagaagtttttaac
tctggtgccgtggctttccttgattcgttatgtgcaaaatttgttgatgaagtacccgag
ctattagctaagcgtaagcaaaaacaagcccgtattgataatggtgagttacctgatttt
ttacctgaaactcgtgcaattcgtgatggtaattggactatccgtggaatgcctgaagat
ctcactgatagacgtgttgaaattaccggccctgttgatcgtaagatgatcatcaatgct
ttaaacgctaatgtaaaagtgtttatggccgactttgaggattcattagcaccgagttgg
caaaaaattgtcgaaggacaaattaaccttcgtgatgccgtgcgcggtgatattgaacta
actgtccctgaaacaggtaagcattattcgttaaatccggatcctgcagtgttaattgct
cgtgtacgtggtttgcatcttattgaaaagcacattgaatacaaaggcaaacccattcct
ggcggcttagtcgattttgctatgtacttttaccataattatcgtcaacttttagctaaa
aaatctggaccttacttttatattcctaagttagaaagccatatagaagcgcgttggtgg
gcgaaaatgtttgcctttgtagaagaacgtttttgcttacagcctggcaccattaaatgt
acttgtttaattgaaacattacctgcggtatttgaaatggaggagattctttatgaactt
cgttcaaacattgtcgcgctgaattgtggccgttgggattatatcttcagctacatcaaa
accttaaagaactatcctgatcgtgtgctacccgaccgtcaagcggtaactatggatact
aaatttttaagtgcctattcacgcttattgattaaaacttgccataaacgtggcgcatta
gccatgggcggaatggcagcatttattcctgccaaagatgaagcaactaacgaactggta
ttacaaaaagtacgtggcgataaggagttagaagctcgcaatggtcatgatggtacttgg
gttgctcatccgggtttagccgacacagcgatgaaaattttcaatgattacatcggtggc
gatagaaccaatcaattacacattactcgtgatgtcgatgcacccattttagccagcgaa
ttactcgagccttgtcaaggcgagcgaactgaagcgggtatgcggttgaacattcgtatt
gcgttgcagtacatcgaagcgtggatccagggcaatggttgcgtaccgatttacggtttg
atggaagatgctgccacagcagaaatatcgcgtacttctatttggcaatggatccagcat
ggtaaaagtttatccaatggcaaactggtcactaaagcattgtttaaagacatgttgaaa
gaggaaacggccaacgtgaaaaaggaacttggcgcggagcgttttaatgcaggtgagttc
gccaaagcggcagaattatttgaacaaattactacctctgatgagctagtcgatttctta
acattaccaggatatgaactgttaacggcgtaa

DBGET integrated database retrieval system