KEGG   Shewanella frigidimarina: Sfri_1102Help
Entry
Sfri_1102         CDS       T00395                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfri_1102
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sfri_1102
Enzymes [BR:sfr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sfri_1102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1302210..1303526
Genome map
AA seq 438 aa AA seqDB search
MTTQLTRQQQVDAIKKDWAENPRWKSVKRPFTAEEVVALRGSVVPENTIAKMGAAKLWEL
VNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPANS
VPAVVSRINNSFRRADQIQWGKEVNPGDDNYTDYFLPIVADAEAGFGGVLNAFELMKSMI
DAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIARTDAN
AADLMTSDCDEYDREFVTGERTNEGFYRVRAGLDQAISRGLAYAPYADLIWCETAKPCLE
EAKKFADAIHAQYPDQLLAYNCSPSFNWKKNLDDVTIAKFQQELSNMGYKYQFITLAGIH
NMWYNMFDLAYDYARGEGMKHYVEKVQELEFAAAKKGYTFVSHQQEVGTGYFDQVTTCIQ
GGKSSVTALTGSTEEEQF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaactaactcgtcagcaacaggttgatgcaattaagaaagattgggctgaa
aatccacgttggaaatcggttaagcgtccttttactgctgaagaagttgtcgcattacgt
ggctctgttgtgccagaaaataccattgctaaaatgggtgctgcaaaattgtgggaactg
gttaacggcggcgctaaaaaaggctacgtaaactcactgggcgcacttactggtggtcaa
gctgtacagcaagcaaaagcgggaatagaagcgatttacttatcaggctggcaggtagct
gctgacgctaacttagcgggcacaatgtatccagaccaatcactttacccagcaaactca
gtacctgcagttgtgagccgtattaataactcatttcgccgtgctgaccagattcaatgg
ggcaaagaagtaaatcctggtgatgacaattacactgactatttcctacctatcgttgct
gatgcagaagccggttttggtggtgtattgaatgcatttgaactaatgaagtcgatgatt
gatgctggtgctgcaggtgttcactttgaagaccaattagcgtctgttaagaagtgtggt
cacatgggcggtaaagtcctcgtaccaactcaagaagcggtacaaaagttagttgctgca
cgtttagcggcagatgtcagtggtgttgataccttggttattgcacgtacagatgctaat
gctgctgatttgatgacttcagattgtgatgaatatgaccgtgagtttgttactggtgaa
cgtactaacgaaggtttctaccgcgttagagctggtttagaccaagctatttcacgtggt
cttgcttatgctccttatgctgatttaatttggtgtgaaacagctaaaccttgtcttgaa
gaagcgaagaaatttgctgatgccattcatgcacagtatccagatcaactacttgcttat
aactgttcaccttcgttcaactggaagaagaacttggatgacgttacgattgctaagttc
cagcaagagttgtctaacatgggctacaagtaccagttcatcacgttagcgggcattcat
aacatgtggtacaacatgttcgatttagcctatgactacgcacgtggtgaaggcatgaag
cattatgttgaaaaagtacaagagcttgaatttgctgctgctaagaaaggttataccttc
gtatcgcaccagcaagaagtgggcacaggttactttgaccaagtgactacgtgtattcaa
ggcggtaaatcgtcagtaacagcgctaacgggctctactgaagaagaacagttttaa

DBGET integrated database retrieval system