KEGG   Shewanella frigidimarina: Sfri_1102Help
Entry
Sfri_1102         CDS       T00395                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sfr01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sfr00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1302210..1303526
Genome map
AA seq 438 aa AA seqDB search
MTTQLTRQQQVDAIKKDWAENPRWKSVKRPFTAEEVVALRGSVVPENTIAKMGAAKLWEL
VNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYPANS
VPAVVSRINNSFRRADQIQWGKEVNPGDDNYTDYFLPIVADAEAGFGGVLNAFELMKSMI
DAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIARTDAN
AADLMTSDCDEYDREFVTGERTNEGFYRVRAGLDQAISRGLAYAPYADLIWCETAKPCLE
EAKKFADAIHAQYPDQLLAYNCSPSFNWKKNLDDVTIAKFQQELSNMGYKYQFITLAGIH
NMWYNMFDLAYDYARGEGMKHYVEKVQELEFAAAKKGYTFVSHQQEVGTGYFDQVTTCIQ
GGKSSVTALTGSTEEEQF
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactacacaactaactcgtcagcaacaggttgatgcaattaagaaagattgggctgaa
aatccacgttggaaatcggttaagcgtccttttactgctgaagaagttgtcgcattacgt
ggctctgttgtgccagaaaataccattgctaaaatgggtgctgcaaaattgtgggaactg
gttaacggcggcgctaaaaaaggctacgtaaactcactgggcgcacttactggtggtcaa
gctgtacagcaagcaaaagcgggaatagaagcgatttacttatcaggctggcaggtagct
gctgacgctaacttagcgggcacaatgtatccagaccaatcactttacccagcaaactca
gtacctgcagttgtgagccgtattaataactcatttcgccgtgctgaccagattcaatgg
ggcaaagaagtaaatcctggtgatgacaattacactgactatttcctacctatcgttgct
gatgcagaagccggttttggtggtgtattgaatgcatttgaactaatgaagtcgatgatt
gatgctggtgctgcaggtgttcactttgaagaccaattagcgtctgttaagaagtgtggt
cacatgggcggtaaagtcctcgtaccaactcaagaagcggtacaaaagttagttgctgca
cgtttagcggcagatgtcagtggtgttgataccttggttattgcacgtacagatgctaat
gctgctgatttgatgacttcagattgtgatgaatatgaccgtgagtttgttactggtgaa
cgtactaacgaaggtttctaccgcgttagagctggtttagaccaagctatttcacgtggt
cttgcttatgctccttatgctgatttaatttggtgtgaaacagctaaaccttgtcttgaa
gaagcgaagaaatttgctgatgccattcatgcacagtatccagatcaactacttgcttat
aactgttcaccttcgttcaactggaagaagaacttggatgacgttacgattgctaagttc
cagcaagagttgtctaacatgggctacaagtaccagttcatcacgttagcgggcattcat
aacatgtggtacaacatgttcgatttagcctatgactacgcacgtggtgaaggcatgaag
cattatgttgaaaaagtacaagagcttgaatttgctgctgctaagaaaggttataccttc
gtatcgcaccagcaagaagtgggcacaggttactttgaccaagtgactacgtgtattcaa
ggcggtaaatcgtcagtaacagcgctaacgggctctactgaagaagaacagttttaa

DBGET integrated database retrieval system