KEGG   Shewanella frigidimarina: Sfri_1203Help
Entry
Sfri_1203         CDS       T00395                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sfr  Shewanella frigidimarina
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sfri_1203
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Sfri_1203
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Sfri_1203
Two-component system [BR:sfr02022]
 CheA family
  CheA-CheYBV
   Sfri_1203
Bacterial motility proteins [BR:sfr02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Sfri_1203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1413859..1415055
Genome map
AA seq 398 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPDLEVVAVAVNGKEAVEMAAKLKPQVITMDIEMPV
MDGITAVREIMANNPTPILMFSSLTHDGAKATLDALEAGALDFLPKRFEDIATNKDDAIL
LLQQRIKALGRRRMYRSSSLTPTSTIESRRSTIAAPETNTPRRPLSSRLASTTTPVATRS
SLSTTSADRHSANPTTSSISSIRASGKQYKLLLIGTSTGGPVALQKVLTAFPANYPHPIV
LIQHMPAAFTPAFAARLNTLCKIEVKEAENGDVMRPGCAYLAPGGMQLMIERSGISGRLK
VISGTQEMNYKPCVDITFASASKAFGGDVLAVVLTGMGADGREGARMLKSVGATIWAQDE
ASCVVYGMPQAVASTGISTHSISLDNMAEAILKESSRG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccataaaagtactagttgtagatgattctagcttttttcgacgtcgagtcagtgag
attgtcaatcaagatcctgatctcgaagtcgtcgcagttgccgttaacggcaaagaagct
gttgaaatggctgcaaaattaaagcctcaagtcattacgatggatattgaaatgcctgtg
atggacggtataactgctgtccgtgaaattatggctaataatcctacacctattttgatg
ttttcatcattaactcatgatggtgctaaagcgacacttgatgcgttagaagccggcgca
ttagattttttgccaaaacgttttgaagatatagcaacgaataaagacgatgcgattctt
ttgttacagcaacgaattaaagcgttaggtcgacgtaggatgtatcggtcaagttcgtta
acaccgacttcaacaatagaatctcgtcgttcaacgattgctgctccagagacaaatacg
cctcgccgcccgttaagtagtcgtttggcttccacaacaacgccagtagcgactcgttcc
agtttatcaacaacctcggcagatcgtcatagcgctaatccgacaacgtcttcaatatca
tctattcgggccagtggtaagcaatataaattgttactcattggaacttcaactggtgga
ccagtagcattacagaaagtattaactgcatttccagcaaattatcctcatcctattgtg
ttgatacagcatatgcctgcggcgtttactccagcttttgcagctcgtttaaataccttg
tgtaaaattgaggtaaaagaagccgaaaatggtgatgttatgcgccctggttgtgcttat
ttagcgcctggaggcatgcagctcatgattgagcgaagcggtatttctggaagacttaaa
gtcatctctggaactcaagaaatgaactataaaccgtgtgttgatattacttttgcatca
gcatccaaagcttttggcggtgatgttttagcggttgtattaaccggaatgggggctgac
ggtagagaaggtgccagaatgttgaagtctgttggtgccactatttgggcacaggatgaa
gcaagctgtgtggtatatggtatgcctcaagctgtggcatcaaccggtatctcgactcac
tctatttcgttggacaatatggctgaagctattttaaaagagtctagtcgtggctaa

DBGET integrated database retrieval system