KEGG   Shewanella frigidimarina: Sfri_1389Help
Entry
Sfri_1389         CDS       T00395                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sfr  Shewanella frigidimarina
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sfri_1389
   00052 Galactose metabolism
    Sfri_1389
   00500 Starch and sucrose metabolism
    Sfri_1389
   00520 Amino sugar and nucleotide sugar metabolism
    Sfri_1389
Enzymes [BR:sfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sfri_1389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1653825..1654715
Genome map
AA seq 296 aa AA seqDB search
MKVVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYIVDECVSAGIKEIVLVTHASKNAI
ENHFDKSYELESTLEKRVKRQLLHEVQAICPKNVTIMHVRQGEAKGLGHAILCAKPCIGD
NPFAVVLPDVILDSYSADQRTENLASMLIRYRESNVSQIMVAPVPDDQVNKYGIADCGGE
TINPGDSTKIFKMVEKPEIGLAPSNLAVVGRYVLSEKIWDLLAKTLPGAGDEIQLTDAID
MLIESDTVEAFNMTGKSHDCGDKLGYMKAFVEYGLRDPKLGNSFMKEVSSLLEEYK
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgttattcctgttgccggtttaggtactcgtatgttgcctgctaccaaggct
attccgaaagaaatgttacctttggtcgataagccgctgattcaatatattgtcgacgaa
tgtgtaagtgcggggattaaagagattgtattggtaactcatgccagtaaaaatgccatt
gaaaaccattttgataaatcttacgagcttgaatctactctagagaaacgtgtaaaacgt
cagctattgcatgaagtacaagccatttgtcctaaaaacgtcaccattatgcatgtgcgc
caaggcgaagctaaagggttaggacatgcgattttatgtgcaaaaccatgtattggcgat
aatccgtttgcggttgtgttacccgatgtcatcttagattcgtattctgctgatcagcgc
accgaaaacctagcctcaatgttaattcgttatcgtgaatctaatgtcagccaaataatg
gttgcaccagtaccagatgaccaagttaataaatacggcattgcagattgtggtggcgaa
accataaatcctggtgactcgactaaaatatttaaaatggttgaaaaaccagaaattggc
ctggcaccgtcaaatttagccgttgttggtcgctatgtgttgtctgaaaagatatgggac
ttactggcaaaaacacttcctggtgcaggtgatgaaattcagttaaccgatgccattgac
atgttaattgagtctgacacggttgaagcgtttaatatgaccggtaagtcacacgattgt
ggcgacaagcttggctacatgaaagcatttgttgaatatggtttacgggatcctaaattg
ggtaacagctttatgaaagaggtctctagtttgttagaagagtataaatag

DBGET integrated database retrieval system