KEGG   Shewanella frigidimarina: Sfri_1424Help
Entry
Sfri_1424         CDS       T00395                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00260  Glycine, serine and threonine metabolism
sfr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01130  Biosynthesis of antibiotics
sfr01230  Biosynthesis of amino acids
Module
sfr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfri_1424
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfri_1424
Enzymes [BR:sfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfri_1424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA Amidohydro_2 His_biosynth
Motif
Other DBs
NCBI-ProteinID: ABI71276
JGI: Sfri1424
UniProt: Q084N9
Structure
PDB: 

Jmol
Position
complement(1697930..1698733)
Genome map
AA seq 267 aa AA seqDB search
MSNRYQAKFAALKAQNKGAFVPFVTIGDPSPELSLKIIRTLVDNGADALELGFPFSDPLA
DGPVIQGANLRSLAAGTTSSDCFDIITKVRAQHPDMPIGLLLYANLVFANGIDEFYAKAQ
AAGVDSVLIADVPVEESAPFSKAAKAHGIAPIFIAPPNADADTLKMVSEQGEGYTYLLSR
AGVTGTESKAGEPIENILAQLAEFNAPPPLLGFGIAEPEQVRAAIKAGAAGAISGSAVVK
IIEAHQLDETTLLAKLAEFTAAMKAAT
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaccgttatcaagcaaaatttgctgcactaaaagcacaaaataaaggtgcattt
gttccttttgtgaccattggcgatccgagccctgaattatcattaaaaattatccggacc
ttagtcgataatggtgctgacgcccttgagttaggctttcctttttcagatccattagcc
gatggccccgttatacaaggtgctaacttacggtcattagcggcaggtacaacttctagt
gattgttttgacatcatcactaaagtccgcgctcaacaccctgatatgcctatcgggtta
ttgctttatgccaacctagtttttgctaatggtattgatgagttttacgctaaagctcaa
gctgctggtgtggattcagtgttgattgctgacgtgcctgttgaggagtctgctcccttt
agtaaagccgccaaagcacatggtattgcacccatctttattgcaccgcccaatgctgat
gctgacaccttaaaaatggtcagtgaacaaggtgaaggttacacctatttgctatcacga
gctggcgtcacgggtacagaatccaaagctggcgagccaattgaaaacattctggcacaa
ctcgccgagtttaatgcgccgccaccactattaggttttggtattgccgagcctgagcaa
gtacgagcagccatcaaggcgggcgctgcaggtgctatttcaggttctgcagtggttaaa
atcattgaagcacatcaacttgatgaaaccacattactggcgaaactggctgaatttacc
gctgcaatgaaagcggcgacataa

DBGET integrated database retrieval system