KEGG   Shewanella frigidimarina: Sfri_1425Help
Entry
Sfri_1425         CDS       T00395                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfri_1425
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfri_1425
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sfri_1425
Enzymes [BR:sfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sfri_1425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1698726..1699937)
Genome map
AA seq 403 aa AA seqDB search
MTELKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQQDESFIAEFTDLLKNYAGRPTAL
TLTRNLSPNPLVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDIERQSPNVFRMKLMGAEVIPVTSGSSTLKDACNEAMRDWSA
SYDKAHYLLGTAAGPHPFPTIVREFQRMIGEETKKQILEKEGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKSPLMQNSDGQIEESYS
VSAGLDFPSVGPQHAHLNAIGRARYESATDDEALEMFQTLARCEGIIPALESAHALAYAV
RMAKEATKETILVVNLSGRGDKDIFTVADILEAKQKQQESGNE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcaagcttaacccttatttcggcgaatacggtgggatgtacgtaccgcag
attttagtgcctgcattaaaacaacttgaaacggcctttgttgaagcacaacaagatgaa
agctttatcgctgagttcaccgacctgttgaaaaactatgctggccgcccaacagcgcta
acacttactcgtaatttaagtccaaatccgctggtgaaaatctacctaaagcgtgaagac
ttactccacggtggtgcgcataaaaccaaccaggtattaggtcaggctttgttagctaag
cgaatgggtaaaaaagaaatcattgccgaaacaggcgctggccaacatggtgtggccaca
gccctagcctgtgcgcttttaggcttaaaatgtaaagtctacatgggtgcaaaagacatt
gagcgtcagtctccaaacgtatttagaatgaaactaatgggcgctgaggttattccagtt
acatcgggttcatcaaccttaaaagatgcctgtaacgaagccatgcgcgactggtctgca
agttatgataaagcgcattacttattaggtacagcagccggcccgcacccattcccgaca
attgtgcgtgaattccaacgaatgattggtgaagaaaccaagaaacaaattcttgaaaaa
gaaggtcgtttacctgatgccgttatcgcgtgtgtaggcggtggctcgaacgctataggc
atgtttgccgactttattgacgaaccgtcagtggaattaattggtgtagaacctgctggt
aaaggcattgataccccgatgcacggcgcgccgcttaaacatggtaaaaccggtattttc
tttgggatgaaatcacccttaatgcaaaatagcgacggtcaaattgaagagtcatattcg
gtttcagcggggcttgatttcccatccgttgggccacaacatgcgcatttaaatgccatt
ggtcgtgctcgttatgagtcagcaaccgatgatgaagcacttgaaatgtttcaaacgctc
gctcgttgcgaagggattattcctgcattagagtctgcccatgccctagcctatgctgta
cgcatggcaaaagaagccactaaagaaaccattttagtggttaatttatccggccgtggt
gacaaagatatctttacagtggcagatattttagaagccaaacaaaaacaacaggagagc
ggcaatgagtaa

DBGET integrated database retrieval system