KEGG   Shewanella frigidimarina: Sfri_1898Help
Entry
Sfri_1898         CDS       T00395                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sfri_1898
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfri_1898
   00620 Pyruvate metabolism
    Sfri_1898
   00650 Butanoate metabolism
    Sfri_1898
  Lipid metabolism
   00071 Fatty acid degradation
    Sfri_1898
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sfri_1898
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sfri_1898
   00626 Naphthalene degradation
    Sfri_1898
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sfri_1898
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sfri_1898
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2245498..2248095)
Genome map
AA seq 865 aa AA seqDB search
MTVTNTQELDLLVERVAKAQAEFANFSQEKVDTIFRAAALAAADARISLAKMAVTETGMG
VLEDKVIKNHFASEYIYNKYKDEKTCGILSEDLTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKNSTTTAARIVLDAAVAAGAPKDIIGWIDQPSVALSNQ
LMTHAKVNLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYKQVKERFISHGGHILSKAETAAMQSVILKNGGLNADIVGQS
AVSIAAMAGFEVPSTTKVLIGEVTDINDAEAFAHEKLSPLLGMYKAKDFNEAMDKAEALV
TLGGIGHTSGLYTDQDTQDERVKAFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKMVAKRAENMLWHKLPSSIYFRRGSLPIALEELSDKKRA
LIITDKFLFNNGYCNETLKILKAQGLETEVFYEVEADPTLAIVRQGAKVAQSFQPDVIIA
LGGGSPMDAAKIIWVMYEHPEVDFADLALRFMDIRKRIYKFPKMGVKAQMVAIPTTSGTG
SEVTPFAVVTDEVTGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAVTHALEAY
VSVMANEYSDGQALQALDLLFKYLPDSYEFGAKAPVAREKVHNGATIAGIAFANAFLGVC
HSMAHKLGAEFHLAHGLANALLISNVIRFNATDMPTKQAAFSQYDRPKALCRYAAIADYL
KLGGKTDAQKVEKLIEKIEQLKTTIGIPASIQDAGVNEADFIAKLDELAEDAFDDQCTGA
NPRYPLIKELKQVLLDSFYGRAYKD
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgacagtcaccaatacacaagagcttgatttattagttgagcgcgtggccaaagcccaa
gccgagtttgccaattttagccaagaaaaagttgatactatctttagagcggcagcctta
gctgcagcagatgcgcgcatatctctggcgaagatggccgtaacagaaacggggatgggt
gtattagaagataaagtgattaaaaaccactttgcatctgaatacatttataacaaatac
aaagatgaaaaaacctgcggtattttatctgaggacttaaccttcggtaccattaccatt
gcagagcctgtaggtattatttgcggtattgtcccaacaactaaccctacttctactgct
atttttaaagcgcttattagcttaaaaacccgtaatggcattattttttcgccgcaccca
agagctaaaaactcaaccacaacggcagctagaattgttttagatgcagccgttgcagca
ggtgcccccaaagatattattggctggattgatcaacctagtgttgccttgtctaatcag
ttaatgactcatgcgaaagttaacctcattttagccactggtggaccaggcatggttaaa
gcggcctattcatctggtaaacctgccattggtgttggtgctggtaatacacctatcgtt
atcgatgagaccgcagacatcaaacgcgcggtaagctctatattaatgtcaaagactttc
gacaatggtgtggtgtgtgcatctgaacaagcggtaattgtagtagacagcatttataag
caagttaaagagcgttttatcagccacggtggtcatattctatctaaagctgaaaccgca
gccatgcagagtgtgatccttaaaaacggcggccttaatgctgatatcgttggccaaagt
gcagtgtctatagctgcaatggctggttttgaagtgcctagtaccaccaaagtgcttatc
ggtgaagtaactgacattaatgatgctgaagcctttgctcacgagaaattatccccgtta
ttagggatgtataaagcaaaagactttaatgaggcaatggacaaagcggaagctttagtc
accttgggtggtattggccatacatctggtttgtataccgatcaagatacccaagatgaa
cgcgttaaagcctttggttttagaatgaaaacagcccgtattttgattaacacacctgct
tcacaaggtggtatcggtgacttatataatttcaagctagcaccatcgttaacactaggt
tgtggttcatggggcggtaattcaatttctgagaacgtcggcccaagtcatttaatcaat
aaaaaaatggtcgctaagagggctgagaacatgttgtggcataagcttccatcatctatt
tatttccgtcgcggtagcttaccaatagcacttgaagaattaagtgataaaaaacgcgcg
ttgatcatcactgacaagttcttatttaataacggttactgtaatgaaaccttaaaaatt
cttaaagcacaagggcttgaaaccgaagtgttctacgaggtagaagccgacccaacctta
gctattgttcgtcaaggtgctaaagttgcgcaaagcttccaaccggacgtcattatcgcg
ttaggtggtggctcaccaatggatgcagcgaaaatcatttgggttatgtacgaacaccct
gaggttgattttgctgatttagcgctgcgtttcatggatattcgtaaacgtatttacaaa
ttccctaaaatgggtgttaaagctcaaatggttgccattccgacaacctcaggtacagga
tcagaagtgactccttttgccgtggtaaccgatgaagtaaccggaaagaaataccctatt
gccgactatcaattaacaccgaacatggcgattgtcgatcctaacttagtcatggacatg
ccaaaatcattgaccgcttttggtggtattgatgctgtcacacatgcgttagaagcttat
gtgagtgtaatggcaaacgaatacagtgatggccaagcactacaagcattagacctattg
tttaagtacctaccggactcttatgaatttggtgcaaaagcgccagtcgctcgtgaaaaa
gtccataatggtgccaccatagccggtattgcttttgccaacgcattcttaggcgtttgt
cactcaatggcgcacaaattaggtgccgaattccacttagctcacggtttggctaatgca
ctactaatctctaacgtgatccgctttaacgcgacagatatgccaactaagcaagcagcg
tttagtcaatacgaccgtcctaaagcgttgtgtcgttatgctgccattgcagattattta
aagctaggtggtaaaactgatgctcaaaaagttgaaaaactgattgagaaaatcgaacag
ctgaaaacaaccattggtatccctgcatcaattcaggatgctggtgttaatgaagcagat
tttatcgccaaactggatgaacttgctgaagatgcatttgatgatcaatgtactggtgcc
aatccacgttacccgttgattaaagagcttaaacaagtgctattagacagcttctatggc
cgagcttataaagactag

DBGET integrated database retrieval system