KEGG   Shewanella frigidimarina: Sfri_1927Help
Entry
Sfri_1927         CDS       T00395                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sfr  Shewanella frigidimarina
Brite
Enzymes [BR:sfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sfri_1927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2281991..2283013
Genome map
AA seq 340 aa AA seqDB search
MHNTQNLEQTSHILHLALPKMATLSIPVTPENYAIWFDYFAERNLNLKRAIDGLIANGVQ
FTPEVNLGLYNRFIEEQSPEVIENVQIETQILINSLLNKIEQLNVGTESFSTNLNEFGEK
LQTNPNTDELNLIVGSIIAEVDQVIANNHQMSASLESLSDEIANLKDEMENLSKVAMTDE
LTSLKNRRSYELFAAEQMTKFVDTQTVCSLLMIDIDNFKMFNDTFGHLIGDKVLAYVALA
MKHTVKGDDLVARYGGEEFVVMLPNAKLIDAVNVAEKIRERIALKQLSIGKEKKQNLGHI
TVSIGVATIQTGDDVDTLLSRADEQLYIAKAAGKNCVKFG
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcataatacccaaaatctagaacaaacctcgcatatactgcatttagcgttacctaaa
atggcgaccttatcgattcctgttacgccagaaaactatgctatttggtttgattatttt
gctgagaggaaccttaatttaaaacgcgcaattgacggtttaattgctaatggtgttcaa
tttactcccgaagttaatttaggcttatacaatcgatttattgaagagcaatcaccagaa
gttattgagaacgtacaaatcgaaactcaaatcctgattaacagcttactaaataagatt
gagcagttaaatgttggcactgaatcattttcaactaacctcaatgaatttggtgaaaag
ctacaaacaaatcctaatactgatgaacttaatcttattgttggctctatcatcgccgaa
gttgaccaagtcattgctaataatcatcaaatgtctgcaagtcttgaatcattatcggat
gaaattgccaaccttaaagacgaaatggaaaatttgagtaaagtggctatgacggatgaa
ctcacatcgttaaaaaaccgccgctcctatgaattgtttgccgcggagcagatgaccaag
tttgtcgacactcaaacagtatgcagtttgttgatgatagacatcgataatttcaagatg
tttaatgatacttttggacacttaattggtgataaagtgttggcttatgtggctttagcc
atgaagcataccgttaaaggcgatgatttggttgcccgctatggtggtgaagagtttgtg
gtaatgttgcccaatgccaagcttattgatgccgttaatgtggctgaaaaaatacgtgaa
agaattgcattaaaacagctttctattggcaaagaaaagaaacagaacctgggccatatt
accgtttctattggtgtggccactattcaaacgggtgatgatgtagataccttattatcg
cgtgctgacgaacaactttatattgccaaagccgctggtaaaaattgcgtcaagtttggt
taa

DBGET integrated database retrieval system