KEGG   Shewanella frigidimarina: Sfri_2165Help
Entry
Sfri_2165         CDS       T00395                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sfr  Shewanella frigidimarina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2584271..2586505)
Genome map
AA seq 744 aa AA seqDB search
MTVATPYFQQGSEIALLNGEYTDVFSLLGMHSVNDGKALVVRCLIPGAISVDVLSAKDGR
KVATLEQVNEHGLFAGKMGRRVKSFAYLLRVQYPLCEQLINDPYQFDSLLNPDDVYLFGE
GSQLQTYHFQGANWREHHGVKGVHFCVWAPNAKQVAVMGDFNLWDNKRHILRHHPASGLW
DIFIAEVEPEQHYKYAISDMHGNQVIKSDPYAVAMQPSPHNASKIPHVERYDWQDSQWLA
DRASHQPHVQPMSIYEVQLASWRRKGDDSQEYTDYSQLIAELVPYIKEMGFTHLQLMPIS
EYPFDGSWGYQPVGLFAPTYRFGDANGLRAFIDECHQQGIAVLLDWVPAHFPRDPHGLVR
FDGSCLYEHDDPRKGEQPDWDTLIYNYGRAEVRSFLYSNAHYWLDEFHFDGLRLDAVSSM
LYLDYSRRADQWIPNKFGGRENLEAISFLQELNARMYQCFPGINMIAEESTAWPGVTQAT
SNNGLGFGFKWNMGWMNDTLRYISCDPLFRRYHHGELTFSLVYAFTEQFILSLSHDEVVH
GKGSLLHKIPGDDWQKFATLRAYYGFMWTHPGKKLLFMGNEFAQRNEWNHNQSLDWHLLT
YAPHQGVQDWVRDLNQCYQQYPALYQRDHHSDGFQWLDCNNADNNILVFCRFGMDKQQHV
VIVVNMSPQVYYDFRVGVPTAQNYRELLNSDHRHYGGGDVVNDNPCEAQVTPWQGMSHSI
VITVPPLGCSIWVPELDEQDQPTQ
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgactgtagcgaccccgtattttcaacaaggtagtgaaatagccttattaaatggtgag
tacacagatgtgttttcactgcttggcatgcacagtgttaatgatggtaaagcgctggtt
gtccgttgcttaatacctggtgcgatcagtgttgatgtgttgagcgctaaggatggacgt
aaagtggcaacacttgagcaagtaaacgagcacggtttatttgccggtaaaatgggccga
agagtgaaatctttcgcttatttattacgggtacaatatcccttgtgtgagcaacttatt
aacgatccatatcaatttgacagcttactcaaccctgatgacgtgtatttatttggcgaa
ggaagccagttgcaaacataccattttcagggggctaattggcgcgagcatcacggtgtg
aaaggggttcatttttgtgtttgggcgcctaatgctaagcaagttgcggtgatgggtgat
tttaatttatgggacaataagcgccatatattgcgtcaccatccagccagtgggctgtgg
gatatttttattgctgaggttgagcccgaacaacactataaatacgccattagcgatatg
catggcaatcaagttattaagtccgatccttacgcggtcgccatgcaaccatcacctcat
aatgcctcgaaaatccctcatgtcgaacgttacgactggcaagatagtcaatggttagca
gatcgggcaagtcatcagccacacgtacaacctatgtctatctatgaggtgcaattagca
tcgtggcgacgcaagggggatgacagccaggaatatactgattactcgcagttaattgcc
gagttggtgccttatatcaaagagatgggttttacccatttacagttaatgccaatcagt
gaatatccgtttgatggctcttggggatatcaacccgtagggttatttgcccctacgtat
cgctttggtgatgccaatggccttagagcttttattgatgaatgccaccagcaaggcatt
gcggtgttactcgattgggtgccagcacattttcctcgcgatcctcatggcttggtgcga
tttgacggtagttgcttgtatgaacatgatgatccccgcaaaggcgaacaaccggattgg
gacacactaatttataattatggccgcgcagaagtacgcagttttttatacagtaatgcc
cattactggttagatgaatttcattttgatggcttaaggcttgatgctgtatcgtctatg
ctctacctcgattacagcagaagagcggatcaatggatcccaaataaatttggcggtcgt
gaaaaccttgaagctatcagctttctacaagaattaaatgcgcgcatgtaccaatgcttc
ccaggcattaacatgattgctgaagagtccaccgcatggccaggtgtgacgcaagcaacc
agcaataatggcttaggattcggttttaagtggaatatgggctggatgaacgacactctg
cgttatatcagttgcgatcccctttttaggcgttatcaccatggtgaacttacttttagc
ttggtgtatgcctttacggaacaatttattttgtcactcagtcacgatgaagtagttcac
ggcaaggggtcgttactgcataaaattccgggtgatgactggcagaagttcgccacatta
cgtgcttattatggctttatgtggactcatcctggcaaaaaattattgtttatgggtaac
gaatttgcccagcgcaacgaatggaaccataaccagagcctagactggcatttattaacc
tatgcaccacatcaaggtgtgcaagattgggtgcgcgatctcaatcaatgctatcaacaa
tatcctgcattatatcaacgcgatcatcatagcgacggtttccaatggctcgactgcaac
aatgctgacaataacattttggtgttttgccgttttggaatggacaagcaacaacatgtc
gtgattgtggtcaacatgtctccacaggtttattacgacttcagagtgggtgtacccacg
gcgcaaaactatcgcgaattgcttaacagcgaccatcgccactatggtggcggtgatgtc
gtcaatgataatccctgtgaagctcaggttactccatggcagggcatgtcacacagtatt
gttatcacagtaccaccgttgggttgcagtatttgggttccagaactagacgaacaagat
cagcctacgcaataa

DBGET integrated database retrieval system