KEGG   Shewanella frigidimarina: Sfri_2166Help
Entry
Sfri_2166         CDS       T00395                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sfr  Shewanella frigidimarina
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sfr00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2586519..2588804)
Genome map
AA seq 761 aa AA seqDB search
MGLEKLLYLQGVGAEFIDCFGNLVHIPARDRQGILTTMLLQSSFHQHEHLHDESDPQSFD
VQDFTQQQLSQPRIDARIELLDVQPWLLPLHTFQWCTIDKPHVDVYLPENYVSGFVVTIS
GENIDTISVSANVCDCVIAGEYHINDKRYCQYRLMLDNATLNLGYHQVDLAFNHDPQRKD
TLHGQLMVAPSSAYQGRSAQPFNNNKESWGLNAQLYALRNEAQWGIGDFGNLAELIEYAA
NAGADFILLNPLHAVDISQPDNPSPYSPTDRRRLNPLYIQIEAVDEYKALNGELLSQKWQ
QKRLVLNQAHLINYDEVHSLKYAALEKMYQIFCSHHVKLETPRYKAYKAFLAHDEAALMQ
FVTVEVELASKYFTQDVGFYLYLQFVANEQLQACQLNAKQCGMSIGLIRDLAVGAVSHGA
EISANADLFCDNASIGAPPDPFAEHGQNWGLTPFDPVKLKQHDYSHFIQLVRSNMQSCGA
LRIDHVMGLLRLWWWPLHEELGNGCYVYYPLETLLAIVCLESQRARCIVIGEDLGIVPPE
IVACLKEAGILSNELFYFCKDHNRFKSPQNYKRQSLMMLANHDVPTLSAWWFGADLRLRR
QLELIETDDKLQQAIDQRQQEKLQLIDLLIREQEFELPTSITSVEQLDFDSVLLAWIRVA
ANGNAQLFSVQLSDLVADKHGVNIPGTWKAFPNWQRRLPLSIKQMSQSPKVQQRLEAIAS
ARKSRTQASAVNTSAVNTSAVNTRTVNTNTENTSSSDKLTY
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgggactagagaagttgctatatttgcaaggcgttggggcagagtttatcgattgtttc
ggtaatcttgttcacatacccgctagggacaggcagggcattttaaccacgatgttattg
caatcatcgtttcatcaacatgaacatcttcatgatgagtccgacccgcaatcatttgat
gtacaggattttactcagcagcaattatcacaaccaaggatagacgcacgaatagagcta
ctcgatgtacagccttggttgcttccgctacatacttttcaatggtgtactattgataag
cctcatgttgatgtctatctgccagagaattatgtatctgggtttgtggtgaccatcagc
ggtgaaaatattgacacaatctcggtgagtgccaatgtatgtgattgtgttattgctggc
gaatatcatattaatgataagcgttattgccaatatcgcttaatgcttgataacgctaca
ttgaatttaggttatcaccaagttgatttagcgtttaatcatgatcctcagcgtaaagac
accttacatggacagttgatggttgcaccgtcttcggcttatcaaggtcgttcagcgcaa
ccatttaacaacaataaggaatcatggggacttaatgcgcaactgtatgctttacgtaat
gaggcgcaatggggcattggtgattttggcaatttagctgaacttatagagtatgctgcc
aatgccggtgcggattttatccttctcaatccactacatgctgtagacatcagccagcca
gataaccctagtccatacagtccaacggaccgccgtcgattaaaccctttatatatacaa
attgaagccgttgatgaatataaggccctcaatggggaactattatcacagaagtggcaa
caaaaaaggttagtgctgaatcaagcacatcttataaattacgatgaagtgcatagcctg
aaatacgcagccttagagaaaatgtatcaaatattttgttctcaccacgtcaagctcgaa
acgccacggtacaaagcctataaggcgtttttagcacatgatgaagctgcactgatgcag
tttgttaccgttgaagtggaattggcatctaaatatttcactcaagatgttggcttttat
ttgtatctacaatttgtcgctaatgagcaattacaagcttgccagttgaatgcaaaacaa
tgtggtatgagtattgggcttattcgtgatttggctgtcggggctgtgagtcatggcgcc
gaaattagtgccaatgccgatttgttttgtgacaacgccagtattggtgcaccgccagat
ccttttgctgaacatggccaaaattggggtttaaccccattcgatccggttaaattaaaa
cagcatgattatagtcattttatccagttggttcgcagtaatatgcaaagttgcggggca
ttgagaattgatcatgtcatgggattattgcgtttgtggtggtggccactacatgaagaa
ctcggtaatggttgttatgtctattatccgttagaaaccttgttagccattgtttgttta
gaaagtcagcgcgctcgttgtatcgtgattggcgaagatttaggcatagtaccaccggaa
attgtggcgtgtttgaaggaagccggcattttatccaatgaattattttatttttgtaaa
gaccacaatcgcttcaaatcaccacaaaactataagcgtcaaagcctgatgatgctggct
aatcatgatgtaccaacgctttctgcgtggtggtttggtgctgacttacgtctacgacgt
cagctcgaattgattgaaaccgatgacaaattacaacaggccatagaccagcgtcagcaa
gagaaactgcaattgattgacttgcttatccgcgaacaggaatttgaactaccaacctcc
attacatcggttgaacaattagattttgacagtgtgttattggcctggatacgtgttgcc
gcaaatggcaatgcacaactgtttagtgtgcaattaagtgatttagtcgccgataaacac
ggggtaaatattcccggcacctggaaagcattccctaattggcagcgtcgattacccctt
tcaatcaaacaaatgtcccaaagccctaaagtgcagcaacgtctagaagcgatagcatca
gcccgaaagtcccgaactcaagccagtgcagttaacacaagtgcagttaacacaagtgca
gtaaatacaagaacagtaaacacaaatacagaaaacacatcgtcatccgataaacttacc
tattaa

DBGET integrated database retrieval system