KEGG   Shewanella frigidimarina: Sfri_2307Help
Entry
Sfri_2307         CDS       T00395                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfri_2307
Enzymes [BR:sfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sfri_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2751550..2752395
Genome map
AA seq 281 aa AA seqDB search
MGSVTTKRHPNGLDYVAVDTALCQARIFMQGAQIDQFIPVGKAPLLWVSSADDYQPGNGI
RGGIPICWPWFGMSDTPGFPQHGFARNKTWSLESVKMRNQLVDLVFTLPASEMDKQYWPH
NTQVKVLFTLGETLSVSLVNTNNGNDNVILTQALHSYFPIEDIHQLKVSGFTGSQYIEFG
EGPFKQVDDVVKFERETDRVYTQLGDTQELHTQNGTIVVSRENSQSAVLWNPWIDKSMRL
SRFNADDYLTMVCLEAANVLDDSVTLAPGQSHTLTTHISWK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggttaccactaaaagacatcccaatggtcttgattatgttgctgttgacaca
gcactttgccaagcacgtatttttatgcaaggtgcacaaatagatcaatttatacctgtc
ggcaaagcaccactattgtgggtatcaagtgcagatgattatcaacctggtaatggtatc
agaggtggaatccccatttgctggccttggtttggcatgagcgacactccagggtttccg
cagcatggctttgcacgaaacaaaacctggtcgcttgaatctgtcaaaatgcgtaaccaa
ttagtagacttagttttcaccttgcccgccagtgaaatggataaacaatattggcctcat
aatacccaagtaaaggtgttattcaccttaggcgaaaccttatcggtcagcctagtgaat
actaataatggaaatgataacgtaatactgacccaagcattgcatagctactttcctatt
gaagatattcatcaattgaaagtgagtggctttactgggtcgcaatacattgagtttggt
gaagggccgtttaaacaagtcgatgatgtcgtcaagtttgaacgagaaaccgaccgggtt
tacacccaattaggtgatactcaggagctacatacacaaaatggtaccattgtagtcagt
cgcgaaaacagccaatccgctgtactttggaacccttggatagacaagtcgatgcgcctt
tcacgctttaatgccgatgattacctaaccatggtgtgcttagaagccgctaatgttctg
gacgacagtgtgactttagcgccagggcaaagccatacgttaaccactcatattagctgg
aaataa

DBGET integrated database retrieval system