KEGG   Shewanella frigidimarina: Sfri_2307Help
Entry
Sfri_2307         CDS       T00395                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00010  Glycolysis / Gluconeogenesis
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sfri_2307
Enzymes [BR:sfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Sfri_2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: ABI72153
JGI: Sfri2307
UniProt: Q081B2
Position
2751550..2752395
Genome map
AA seq 281 aa AA seqDB search
MGSVTTKRHPNGLDYVAVDTALCQARIFMQGAQIDQFIPVGKAPLLWVSSADDYQPGNGI
RGGIPICWPWFGMSDTPGFPQHGFARNKTWSLESVKMRNQLVDLVFTLPASEMDKQYWPH
NTQVKVLFTLGETLSVSLVNTNNGNDNVILTQALHSYFPIEDIHQLKVSGFTGSQYIEFG
EGPFKQVDDVVKFERETDRVYTQLGDTQELHTQNGTIVVSRENSQSAVLWNPWIDKSMRL
SRFNADDYLTMVCLEAANVLDDSVTLAPGQSHTLTTHISWK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgggttcggttaccactaaaagacatcccaatggtcttgattatgttgctgttgacaca
gcactttgccaagcacgtatttttatgcaaggtgcacaaatagatcaatttatacctgtc
ggcaaagcaccactattgtgggtatcaagtgcagatgattatcaacctggtaatggtatc
agaggtggaatccccatttgctggccttggtttggcatgagcgacactccagggtttccg
cagcatggctttgcacgaaacaaaacctggtcgcttgaatctgtcaaaatgcgtaaccaa
ttagtagacttagttttcaccttgcccgccagtgaaatggataaacaatattggcctcat
aatacccaagtaaaggtgttattcaccttaggcgaaaccttatcggtcagcctagtgaat
actaataatggaaatgataacgtaatactgacccaagcattgcatagctactttcctatt
gaagatattcatcaattgaaagtgagtggctttactgggtcgcaatacattgagtttggt
gaagggccgtttaaacaagtcgatgatgtcgtcaagtttgaacgagaaaccgaccgggtt
tacacccaattaggtgatactcaggagctacatacacaaaatggtaccattgtagtcagt
cgcgaaaacagccaatccgctgtactttggaacccttggatagacaagtcgatgcgcctt
tcacgctttaatgccgatgattacctaaccatggtgtgcttagaagccgctaatgttctg
gacgacagtgtgactttagcgccagggcaaagccatacgttaaccactcatattagctgg
aaataa

DBGET integrated database retrieval system