KEGG   Shewanella frigidimarina: Sfri_2341Help
Entry
Sfri_2341         CDS       T00395                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00020  Citrate cycle (TCA cycle)
sfr00640  Propanoate metabolism
sfr00660  C5-Branched dibasic acid metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
Module
sfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfri_2341
   00640 Propanoate metabolism
    Sfri_2341
   00660 C5-Branched dibasic acid metabolism
    Sfri_2341
Enzymes [BR:sfr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Sfri_2341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABI72187
JGI: Sfri2341
UniProt: Q080X8
Position
complement(2787600..2788766)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKSLFAEYGLPVSEGFACDTAQEAVEAAGHIGGNLWVVKCQVHAGGRGKAGGV
KVTGNKDEIRAFAENWLGKNLVTYQTDAKGQPVAKILVESCTDIANELYLGAVVDRSTRR
VVFMASTEGGVDIETVAEHTPELIHTAIIDPLTGPQAFQARDLGFKLGLNPTQMKQFTKI
FMGLANMFNDHDFALLEINPLVITTEGNLHCLDGKIGIDGNALFRQPKIKAMHDPSQDDA
REAHAAKFELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGTNAELGREV
LAKSGLDIIAATSLTDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgagtatcaggcaaaatctttatttgccgaatatggtttaccagtctct
gaaggctttgcatgtgatactgctcaagaagcagtagaagcagctggtcacattggcgga
aacttatgggttgttaagtgtcaagtacacgcaggcggccgtggtaaagcaggtggcgtt
aaagttaccggtaataaagacgaaatcagagcattcgctgaaaactggttaggtaagaac
ttagtaacgtaccagactgacgctaaaggtcagccagttgctaaaattctagttgaaagc
tgtactgacatcgctaacgaattgtacctaggtgcagtagttgaccgtagcactcgtcgc
gttgtgttcatggcgtcgactgaaggtggtgttgatatcgaaactgtggctgaacatacg
ccagagcttatccacacagctatcattgatccgttaacaggtcctcaagctttccaagct
cgtgatcttggcttcaagttaggtttaaacccaacacaaatgaagcagtttactaagatc
tttatgggtctagcgaacatgttcaatgaccatgattttgcgttattagaaatcaatcca
cttgttatcaccactgaaggcaaccttcactgtttagatggcaaaattggtattgatggc
aatgcattattccgtcagcctaaaatcaaagcaatgcacgatccatcacaagatgatgct
cgtgaagcgcatgctgctaaatttgaattaaactatgttgctttagacggtaacgtaggt
tgtatggttaacggtgccggcctagcaatgggtacaatggacatcgtgaacctacacggc
ggcaagccagctaacttcttagacgttggcggtggagcaactaaagaacgtgttgcagaa
gcatttaagatcattctttctgacagcaatgttaaagcggtattggttaacatcttcggt
ggtatcgtgcgttgcgatatgatcgctgaaggtattattggtgcggttaaagaagttggc
gttaaagtgccagtcgttgtacgtcttgaaggtactaacgctgaattaggtcgtgaagta
ttggctaagtctggtcttgatatcatcgcggctacaagtctaactgacgcggctgagcaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system