KEGG   Shewanella frigidimarina: Sfri_2342Help
Entry
Sfri_2342         CDS       T00395                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sfr  Shewanella frigidimarina
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:sfr01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sfr00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:sfr00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2788842..2790038)
Genome map
AA seq 398 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKPGEQVTRDQNLVDIETDKVVLEVVAPEDGSISELL
FQEGDTVLGEQVIANFVAGVVSGQEVTKAEASGPAVVATTEAASDESNDALSPSVRRVIA
EHNLDASKIKGSGVGGRVTKDDVDAFLKSAPAKAAAPAAPVAPLEGRSEKRVPMSRLRKT
IAKRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALK
RFPEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRELAIKGR
DGKLSVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPM
MYLALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaattaaggtacccgtattaccagaatctgttgctgatgcaactattgct
acttggcatgttaaacctggtgaacaggttactcgtgatcaaaacttagttgatatcgag
acagacaaagtcgtgttagaagtggtagcaccagaagacggttcaatttctgaattgtta
ttccaagaaggcgataccgttttaggtgagcaagtgattgctaattttgtcgctggtgtt
gtgtctggccaagaagtgactaaagctgaagcttcagggcctgctgtcgtggcaacgacc
gaagctgcttctgatgaatctaatgatgcattaagcccatctgttcgtcgtgtgattgcc
gaacataatcttgatgccagtaaaattaaaggttctggtgtgggcggacgtgtaactaag
gatgatgtagatgcattccttaagtcagctcctgctaaagccgctgcaccagctgctcct
gtagcacctttagaaggtcgtagtgagaagcgtgtaccaatgtcacgtcttcgtaaaact
atcgcaaaacgtcttttagaagcgaaaaattcaacggcaatgttaactacgtttaacgaa
gttaacatgaagccaatcatggatattcgcaaacagtaccaagacattttcgaaaaacgc
catggtattcgtttaggctttatgtctttctatatcaaagctgtgacagaagcgctaaaa
cgtttcccagaagttaacgcttctattgatggtgatgacattgtttatcataactatttc
gacatcagcatcgctgtatcaacgcctcgtggtctggtaactccagtcttgcgtgacact
gataccatgaacttagctgaaatcgaaaaagcggttcgtgaattagccattaaaggccgt
gacggtaaattatctgttgctgacatgactggcggtaacttcactgtgactaacggtggt
gttttcggttcactcatgtctacgccaattttgaacctgccacaaagcgcaatcttaggc
atgcatgccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcctatg
atgtacctagcactctcttacgaccaccgtattgttgatggtcgtgagtcagttggcttc
ttagtcgcgattaaagacttcttagaagatccaactcgtctgctacttgatctgtaa

DBGET integrated database retrieval system