KEGG   Shewanella frigidimarina: Sfri_2346Help
Entry
Sfri_2346         CDS       T00395                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00020  Citrate cycle (TCA cycle)
sfr00190  Oxidative phosphorylation
sfr00650  Butanoate metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01130  Biosynthesis of antibiotics
sfr01200  Carbon metabolism
Module
sfr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sfr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sfr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sfri_2346
   00650 Butanoate metabolism
    Sfri_2346
  Energy metabolism
   00190 Oxidative phosphorylation
    Sfri_2346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABI72192
JGI: Sfri2346
UniProt: Q080X3
Position
complement(2795583..2795930)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSAPLTFEIWNGLFASLPMKVF
TLITLIALLIHAWIGVWQVLTDYVKHTALRGVLQFTFVLIAFSYLASGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaacaaatgcagcaagttttggacgcagtggtgttcatgactatattctattacgc
gcaagtgcagtgatcctcgcttgttatactatttttttagttggctttatcgcgtgtagt
gccccgttaactttcgagatttggaatggtttgtttgcttcacttccaatgaaagtcttt
accctaataaccttgattgctttacttatccatgcgtggattggtgtatggcaagtgttg
actgattatgtcaaacatacagcgttacgtggtgtattacagtttacctttgtgttgatc
gcttttagttatttagcgtcaggcattgtaatagtgtggggtgtttaa

DBGET integrated database retrieval system