KEGG   Shewanella frigidimarina: Sfri_2535Help
Entry
Sfri_2535         CDS       T00395                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sfri_2535
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sfri_2535
DNA repair and recombination proteins [BR:sfr03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sfri_2535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 Helicase_RecD AAA_11 UvrD-helicase UvrD_C AAA_22 AAA_16 DUF2075 AAA_28 AAA_25 PhoH AAA_29 AAA_24 AAA_12 FtsK_SpoIIIE NTPase_1 SRP54 ArgK T2SSE AAA_33
Motif
Other DBs
NCBI-ProteinID: ABI72378
JGI: Sfri2535
UniProt: Q080D7
Position
3037089..3039152
Genome map
AA seq 687 aa AA seqDB search
MLILTHPITELLHLWQEQRLITALDRHFAIELASIETINNDPAISEQQPQLFLLVCAMLS
QQLSNQHSCLVIEQIDLANPMAEDNRGNAGINCRIELNHQQLIEQIALFDAVGQPGDNKP
MIFEHGRLYLNKYHFFETQVAAKLTQLANQQIEIDLANSNLPQLIECLFTAEDSNSSQFN
WQKIATATALAKALAVITGGPGTGKTTTVTKLLLLLLTQSPLTIRLVAPTGKAAARLSES
IKASKHRLLQQLTQVSDPALAKVLTDSLKQIPEEASTLHRLLGVIPNSYQFRHHQDNPLR
LDLLVVDEASMVDLPMMYKLLSALPSHGRLILLGDQDQLASVEAGAVLADICVGLKQANQ
HEASPWSMRYSAAQANLIEQLTQQDVSQFIHQQPKIGDSLCMLMHSHRFRGDAGIGLLAN
AVNQSNVHAIRQVWQHDHAELNWFEHQHNAQGDNTGKQALLALSVSAYGEYLSLVQENQQ
RINQQTIIDQADRQDSVITLPHSEQTIIDSFNQYRVLCAMRAGEFGVEGMNIAITDSLKH
AKLINPQNEFYLGRPIIIQSNDYNLGLFNGDIGLILQDSTKPSRLMAHFVMADGSLLKVL
PARLPSHDTCYAMTVHKSQGSEFDKVSFVLPHKPSSAQWQLLSKELLYTAITRAKNHFYC
LGTSMIFEKASKQATSRASGLAWRLWG
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atgctaatactcacccatccaatcactgagttattgcacctttggcaagaacagcggctc
attaccgcactcgatcgtcattttgctatagagctggccagtattgaaaccatcaataac
gatcccgcaattagcgaacaacagccgcaactgttcttgcttgtttgcgccatgcttagc
cagcaattgtcgaatcagcacagttgtttagtcatcgagcaaattgatttagccaatccc
atggcagaagacaaccgcggcaacgctggaatcaattgtcggattgagcttaaccatcaa
caattaattgaacaaatcgcgctatttgatgccgtcggccagcctggtgacaacaaaccg
atgatttttgaacatggacgcttatatttaaataagtaccacttctttgaaactcaagtg
gcggctaagttgacccaattagccaatcaacagattgaaatcgacctagctaacagtaat
ctgccgcaactcattgaatgtttatttaccgcagaagacagcaatagcagccagtttaat
tggcaaaaaatagccacggcaacagccttagccaaagcattagcggtgatcactggtggc
ccaggaaccggtaaaaccaccacagtaactaaactattattgttattgttaacccagtcg
ccactaacaatccgtttagtcgcgcccacaggtaaagctgcagcaaggctgagtgagtcg
atcaaggcgtctaaacatcgtttactgcaacagctaacccaagtcagcgacccagcattg
gcgaaagtattaactgattcgctaaaacaaatacctgaagaagcctcaacattgcatcga
ttattgggggttatcccaaactcgtaccaattcaggcatcatcaggataatccgttgcgc
ttagatttactggtggtcgatgaagcatcgatggtcgacttacccatgatgtacaaatta
ctcagcgccctaccgtctcatggccgtttgatattgttaggcgaccaagatcaactcgca
tcagtagaagctggcgcagtgctggcggatatttgtgttggcttaaaacaagctaatcag
catgaggcatcgccatggtcaatgcgttacagcgcagcacaggcaaatctcattgagcaa
ttaacccaacaagatgtcagtcagtttattcatcaacaacctaaaattggtgacagtttg
tgtatgttgatgcacagccatcgttttagaggcgatgcaggtattgggttattagccaat
gcggttaatcaatcaaatgtgcatgcgattcgccaagtgtggcaacatgatcatgccgaa
ttgaattggtttgagcatcagcataatgcccagggagataacacaggtaaacaagcgtta
ttggcattatcggtaagcgcttatggtgagtatctgagtttggtacaagaaaatcagcaa
aggataaatcaacagaccattatcgatcaagcggatcgacaggacagcgtcataacattg
ccgcattctgaacaaaccatcatcgacagctttaaccaatatcgagtcttgtgtgccatg
cgagctggggagtttggggttgaggggatgaacatcgccatcaccgacagtcttaaacac
gcaaaactgattaatcctcaaaatgagttctatttaggccgaccaatcattattcaaagt
aacgattataacttgggcttatttaatggcgacattggtttaatcttgcaagacagcact
aagccaagtcgcttaatggcccactttgttatggccgatggcagcctgcttaaagtatta
cccgcacgcttaccaagccacgacacttgctacgccatgacagtacataaaagccaaggc
agcgaatttgataaagtcagctttgtcttgccacataaacccagctccgcccaatggcag
ctactcagtaaagaactgctttacaccgccataacacgcgccaaaaatcatttttattgt
ttaggcacgagcatgatatttgaaaaagccagcaaacaagcgacatcacgcgcatcgggg
ttagcgtggagattgtggggttga

DBGET integrated database retrieval system