KEGG   Shewanella frigidimarina: Sfri_2542Help
Entry
Sfri_2542         CDS       T00395                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sfr00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sfr00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sfr02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3044848..3046446
Genome map
AA seq 532 aa AA seqDB search
MLKQGLSVVIASILSSATYAGSATAATTTDTQLNNAWYKDGQATITEKLQQSRSTRAKNV
ILFVGDGMGISTLTAARILKGQLAGNSGEEGYLSFETFPYSALVKTYNVDAQTPDSAGTM
TAMMSGLKSDAGVLGVDEDVVRGTCASVKGNEVVTALELAEIKGLSTGVLSTARITHATP
AATYAKSADRNWEDISDMDIDNNAERADCEDIASQLVNFEKNLEQRYTGVDVDGIDVVMG
GGRRHFLPKDAAFNSVDAVSAIEGDRTDGRDLTAEWSAMYPNGQYVIDQTGFDAIDTEST
ERVFALFNESHMQYEADRANDIAGEPSLSQMTEKAIKILDNNPKGYFLTVESGRIDHGHH
AGSASTALNDAIEFSNAVQAALDATNDEETLIIVTADHSHVFTIAGYPKRGNPILGKVVG
IGATEPSEDSAGNPYTTLGYSNGLGFRDLGAETDGDASYAAEAVAGRQDITAIDTTTSGY
HQEVTVPLSSETHAGEDVAIHTSGPGAQLVQGTVEQSVVFHLINRALGLVGQ
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaacaaggcttatcagtggttatcgctagtatattgtcttcggcaacatacgca
ggttctgcaaccgcagcgacaacgactgacacacaactcaataatgcttggtataaagac
ggccaagcaaccatcacagaaaaattacaacaatcaagatcaacaagagcaaaaaatgtc
atcttgtttgttggcgatggtatggggatttccacacttaccgcagctcggattttaaaa
ggccaattagccggtaattctggtgaagaaggttacttaagctttgaaacatttccttat
tctgctctggttaaaacctacaatgtagatgctcaaacaccagattcagcaggcaccatg
acagccatgatgagcggcttaaaatcagacgccggggttctgggtgttgatgaagacgtc
gttcgtggtacttgtgcctcagtcaaaggcaatgaagtagtaaccgccttagagttagcc
gaaataaaaggcttatcgacgggtgtgctatcaaccgcacgtattactcacgcaacgcca
gccgccacttatgcaaaatcagcagaccgtaactgggaagatatctcagacatggatatt
gacaataatgctgaacgtgcagattgcgaagatatcgcatcacaactggttaactttgaa
aaaaatctagaacaacgttacaccggtgttgatgtagacggcattgatgttgtgatgggc
ggtggtcgtcgtcattttttacctaaagatgccgcatttaatagtgtcgatgccgttagc
gctattgaaggcgaccgtaccgatggccgcgatttgaccgcagaatggagtgctatgtat
ccaaatggtcaatacgttattgaccaaactggatttgatgccattgatacagaatccact
gaacgtgtttttgctttattcaatgaatcgcatatgcaatacgaagctgaccgagccaat
gatattgcaggcgaacccagcctgtctcaaatgacagaaaaagccattaaaatacttgat
aacaatccaaaaggttacttcttaacggttgagtctggacgaattgaccatggccaccat
gctggcagtgcaagcacagcgcttaatgatgccattgaattttcaaatgctgttcaagcg
gcattagacgcaacaaatgatgaagaaacactaatcattgtcacggctgatcacagccat
gtatttaccattgcaggctatccaaaacgtggtaatcctattttgggtaaagtggtgggt
attggtgcgactgagcctagcgaagattcagctggtaatccttacaccacattagggtat
agcaatggacttggtttcagagacttaggggctgaaacagatggcgatgcatcttatgct
gctgaagctgttgcaggccgtcaagacatcactgcaatcgatacaacaacctctggttat
caccaagaagtgacggttccattgagcagcgaaactcacgcgggggaagatgtggctatt
catacatcaggcccaggtgcgcaattagttcaaggtactgttgaacaaagcgttgtattc
catttaatcaatcgtgctcttggtttagttggtcaatag

DBGET integrated database retrieval system