KEGG   Shewanella frigidimarina: Sfri_2568Help
Entry
Sfri_2568         CDS       T00395                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sfr  Shewanella frigidimarina
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sfri_2568
Enzymes [BR:sfr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sfri_2568
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Sfri_2568
Lipid biosynthesis proteins [BR:sfr01004]
 Fatty acid synthase
  Component type
   Sfri_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3072121..3072708
Genome map
AA seq 195 aa AA seqDB search
MLTSVFILIVMSVPTYAATILILGDSLSAGYGMPEDQGWVQLLRNQLPQHQVINGSVSGE
TTAGGLRRLPSLLASSKPDLIVIELGGNDGLRGFPPNKLKSNLTKIITLSQQQGAKVLLT
EIMVPPNYGPRYAKSFTQIYHQLAEQYTIKLIPFFMQDIATDKALMQRDGIHPNEQAQDT
ITLLMLPWITQALSE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcttaccagcgtgtttatactgatagttatgagtgtaccaacctatgctgccacgatt
ttgatattaggtgatagcttaagtgcaggttatggcatgccagaagatcagggatgggta
caattgttacgtaaccagttgcctcaacatcaggtaattaatggttctgttagtggtgaa
acaacggcgggaggattgcgtagactcccgagtttactggcctcaagcaaacctgatctg
attgtcattgaactaggtggtaacgacggactgcgaggttttccgcctaataaactgaaa
tcaaatcttacaaaaatcattaccctatcgcagcaacaaggcgccaaagtgttattaact
gagattatggtaccaccgaattacggccctaggtatgccaaatcttttactcagatttac
catcaactggccgaacaatatacaattaagttgatcccttttttcatgcaagatattgcc
accgacaaagcacttatgcagcgcgatggaattcatccaaatgaacaagctcaagacact
attacgctgttaatgttaccttggatcacacaagctttatccgagtaa

DBGET integrated database retrieval system