KEGG   Shewanella frigidimarina: Sfri_2759Help
Entry
Sfri_2759         CDS       T00395                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
  KO
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sfr  Shewanella frigidimarina
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Sfri_2759
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sfri_2759
Enzymes [BR:sfr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Sfri_2759
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3315916..3316485
Genome map
AA seq 189 aa AA seqDB search
MKYINTHLEGVMIFSPRKFIDERGFFMETLRQNSFSDAFIQNKMDVPLLVQENQSRSVNN
VLRGLHFQQHFPQGKLIRVARGTIFDVAVDIRQESKTFGQWIGQEISDENGYQMWIPAGF
AHGFYVLSDIADIIYKCSQYYQPDDEQTIAWNDPMLNIQWPLKQHPAPIVSDKDNPTINP
KIISFGLMK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatattaacactcacctcgaaggcgtgatgatttttagtccacgtaagttcatt
gatgaacgcggtttttttatggaaacattacgtcaaaatagctttagtgatgcatttatc
caaaacaaaatggatgtccctctgctcgttcaagagaatcaatctcgctcggtgaacaat
gttttacgcggactgcattttcagcagcactttcctcagggtaaattaatccgtgtggcc
agaggtactatctttgacgttgctgtcgatattcgtcaagagtctaaaacatttggccag
tggataggtcaggaaatttccgacgaaaatggctatcaaatgtggatcccggcaggattt
gcacacggcttttacgtattgtctgacatcgctgatattatttataaatgttcacaatat
tatcaaccagacgatgagcaaaccatcgcatggaatgaccctatgctcaatatacaatgg
cctttaaaacagcaccctgctcctatcgtctcagacaaagataatccgaccataaaccct
aagataatctcatttggtctcatgaaatga

DBGET integrated database retrieval system