KEGG   Shewanella frigidimarina: Sfri_2846Help
Entry
Sfri_2846         CDS       T00395                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sfr  Shewanella frigidimarina
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sfri_2846
Enzymes [BR:sfr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sfri_2846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3429834..3431579)
Genome map
AA seq 581 aa AA seqDB search
MSVMDGLQQKLQQQLSCIYNDVDIDISVPALAAQLIDIMRITEYCQVPEPFVNHWSEKDI
IMITYGDSVIQQGERPLTTLAQFIDSYLSCINAVHILPFFPYSSDDGFSVIDYSSVNEGL
GSWADISAIASKRRLMSDLVINHCSSRSLWFENFCKGEGVGHDYFFTAEPDDDLSAVVRP
RTSTLLRPTETPSGTQHVWCTFSHDQVDFDFRNPQVLIEFVRIIRQYLDAGVSIFRLDAV
AFLWKIVGNKSINLPQTHEVIRLLRTLIEHAQQDVIIITETNIPNTQNLTYFGNANEAHC
IYNFSLPPLLINSLITGSCLYLKRWLMSMPPAQDGTTYFNFIASHDGIGLRPAEGLLEED
EIDTLVDTMKQFGGQISSRTTEDGLQKPYEMNIALFDALQGTTKGKDQWGMQRFVCAHTI
MLALEGIPGIYIHSLLGTRNDYQKLANTSHNRAINRHRWDLNQLTEQLNDANSDHSQVLT
ELTNLINIRTQQIAFHPNATQFTLHLGLQLFGFWRQSRNRKQSIFCISNVSDQITDLRIN
ELNLIIAEHWVDLLSGQPIEDITQTMQLQPYQTVWISNVRI
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtaatggatggattacagcaaaagctgcagcaacaacttagttgtatttacaac
gatgtcgacattgacataagtgtgccagcattggctgcacagctcatcgatataatgcgt
atcaccgagtattgccaagtgcccgaaccctttgtaaatcattggtctgaaaaagacatc
attatgatcacttatggcgacagtgtgatccaacaaggtgagcggccactcaccacgctg
gctcaatttatcgacagctatttaagttgcatcaatgctgtgcatattttaccgtttttc
ccttacagttctgacgatggtttctcggttatcgactattcaagtgttaacgaaggcctt
gggtcgtgggcagatatcagtgctattgccagtaagcggcgattgatgtcagatttagtg
atcaatcattgctctagtcggagcttatggtttgagaacttttgcaaaggtgagggcgtg
ggccatgactacttttttactgccgagccagatgatgacttaagcgcggtggttcggcca
agaacgtcaacattattaagaccaacagagacaccgagcggcactcaacatgtgtggtgt
acctttagtcatgatcaagttgattttgattttcgtaatccacaagtattaatcgagttt
gtacgtatcattcgtcagtatttagatgcgggtgtgagtatttttcgcctcgatgcagta
gcctttttatggaaaatagtcggtaataaatcaattaacttaccgcaaacccatgaagtt
atccgtctattacggacattaattgaacacgctcagcaagacgtcatcatcattaccgaa
accaacattcctaacacccaaaacttaacttactttggtaatgctaacgaagcacattgt
atttataacttctcattgccgcctttactgatcaacagtcttattaccggcagttgctta
tacttaaagcgttggcttatgagtatgccgcccgcacaagacggcaccacctactttaat
tttatagcttctcacgatggtattggtttacgcccggcagaaggcttacttgaagaagat
gagattgatactctggtcgacacaatgaagcagttcggtggccaaatatcatccagaacc
acagaagatggcctgcaaaaaccttatgaaatgaacattgccctgtttgatgccttacaa
ggcaccactaaaggtaaagaccagtgggggatgcaacgttttgtgtgcgctcataccatt
atgttagcgctcgaaggtattcctggaatttatatccatagtttattgggaacccgcaac
gactatcaaaagctggccaatacttcacataatcgcgccattaaccgccatcgttgggat
ctcaatcaattaacggaacaactaaatgatgccaacagcgatcatagccaagtgctaacc
gagctgaccaatttaatcaatatccgaacgcagcaaattgcatttcatcccaatgctaca
caattcaccttacatctagggttacagttatttggtttttggcgtcaaagtcgtaatcgt
aaacaaagtatattttgtatcagcaacgtatcagaccaaatcaccgatcttcgcattaat
gaacttaatcttattattgcagaacactgggtagacctattgagtggacaaccaatagaa
gacatcacccaaaccatgcaactgcaaccctaccaaaccgtgtggattagtaatgtacgt
atctag

DBGET integrated database retrieval system