KEGG   Shewanella frigidimarina: Sfri_2853Help
Entry
Sfri_2853         CDS       T00395                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sfr  Shewanella frigidimarina
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Sfri_2853
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Sfri_2853
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Sfri_2853
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3437992..3438525)
Genome map
AA seq 177 aa AA seqDB search
MIKYITAIGLMALSFSTVAANCPDYLNVEARKLHSTENVNLCELTQGKAVLIVNTASHCG
FTPQFEALEALHKQYADKGLVVIGFPSDDFFQEEKDEAKTADVCFINYGVTFTMVATSPV
RGDEANSVFKYLDDKSAAPKWNFYKYVVSPDGQTVQQFSSRVKPDSEELKNAIESVL
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatacataacggcaattggcttaatggcattaagttttagtactgttgctgca
aattgtcctgattatctcaatgttgaagctcgtaaattacactcaacagaaaacgtaaat
ttatgcgaactcacccaaggcaaagcagtattaatcgttaataccgcatcgcactgtggt
tttacgcctcaattcgaagctcttgaagcattacacaaacaatatgccgataaaggttta
gtggtgattggctttccgtcagatgattttttccaagaagaaaaagacgaagcaaaaact
gccgatgtttgttttattaattatggtgttacatttactatggtggcaacatcacctgtt
agaggcgatgaagctaactccgtatttaaatacttggacgataaaagtgccgcacctaaa
tggaatttctataagtatgttgtttcgcctgacggtcaaaccgtgcagcaatttagttcg
cgtgtgaaacccgatagcgaagaattgaaaaatgcgattgaatcagttttgtaa

DBGET integrated database retrieval system