KEGG   Shewanella frigidimarina: Sfri_2904Help
Entry
Sfri_2904         CDS       T00395                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sfri_2904
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfri_2904
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfri_2904
Enzymes [BR:sfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfri_2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3492486..3493769)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQVVNFSQALQLGLGKDRGLFFPKSIPVLSNIDALLALPFAERSKKVLGAW
LADELGQENVDKLVDKAFTFDVPLVKVDDKRACLELFHGPTLAFKDFGARFMAQCVDLLA
GNKKLTILTATSGDTGAAVADAFYGLDNVNVMVLYPKGKISELQEKMFTTLGKNIHTVAV
TSDFDACQHLVKQAFDDSDVRDGLALNSANSINISRLLAQICYYFEAVAQAKQAGHHELV
MSVPSGNFGNLTAGLFAKAMGLPIKRFIAATNSNDTVPRYLTGGEWQPHKTVATMSNAMD
VSEPSNWPRVEAICEQMGWPLSLVTGVALSEDATAGALAELYQLGYQSEPHAAIAAHALT
LGLTSKETGVFLGTAHPAKFKDVVDRELNINLPLPPELAAVAQKTILSAELDADFEQLKA
HMFAVLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaattatataacttaaaacacccatcgcaggtagttaacttcagtcaagcgcttcaa
ctgggtttaggtaaagatagaggattgtttttcccaaagtccattccagtactatccaat
attgatgcattactggcattaccctttgctgagcgaagcaaaaaagtcttgggtgcttgg
ttagcggatgaactcgggcaggagaatgttgataagcttgttgataaagcatttaccttc
gatgtaccactcgttaaggttgatgataaacgtgcttgtttagaactttttcatggtccg
acattagcgtttaaagattttggcgcacggtttatggctcaatgcgttgatttacttgcc
ggcaataaaaaactgactattttaaccgcaacatcgggtgatactggcgctgcagtagcg
gatgcattttacggcctagataacgtcaatgtaatggtgttataccccaaaggtaaaatt
agtgaactgcaagaaaagatgtttactaccttaggtaaaaatattcataccgtggcagta
acatctgactttgatgcttgtcagcatctggttaaacaagcttttgatgacagtgatgtt
cgtgacggcttagcgttaaattctgctaattcgattaatattagtcgtttattagctcag
atatgctattactttgaagcggtagcgcaagcaaaacaagctggacatcatgagcttgtg
atgtctgtacccagtggtaattttggtaacttaaccgctgggttatttgctaaagccatg
gggttaccaattaagcgttttattgctgcaaccaatagtaatgacacggtaccgcgttat
ctcactggtggtgaatggcaaccacataaaaccgtggcgaccatgtctaatgctatggat
gtgtcagagccaagcaattggcctcgtgtagaagcgatttgtgagcaaatgggctggccg
ttatcattggtaactggcgtggctctttctgaagatgccaccgctggcgccttagcagaa
ctttatcagttgggttatcaatcagagccccatgcggcgattgcagctcatgcattaacg
cttgggttaactagtaaagaaactggggtgtttcttggtacagcgcatcctgctaagttt
aaagatgtggttgaccgtgagttgaacattaatttaccgttacctcctgaattagctgcg
gtggcacaaaaaacgattttatcagcagaattagatgctgactttgagcagcttaaagcg
catatgtttgctgtgctaaagtaa

DBGET integrated database retrieval system