KEGG   Shewanella frigidimarina: Sfri_2904Help
Entry
Sfri_2904         CDS       T00395                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00260  Glycine, serine and threonine metabolism
sfr00750  Vitamin B6 metabolism
sfr01100  Metabolic pathways
sfr01110  Biosynthesis of secondary metabolites
sfr01120  Microbial metabolism in diverse environments
sfr01230  Biosynthesis of amino acids
Module
sfr_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sfri_2904
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sfri_2904
Enzymes [BR:sfr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sfri_2904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: ABI72743
JGI: Sfri2904
UniProt: Q07Z21
Position
complement(3492486..3493769)
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQVVNFSQALQLGLGKDRGLFFPKSIPVLSNIDALLALPFAERSKKVLGAW
LADELGQENVDKLVDKAFTFDVPLVKVDDKRACLELFHGPTLAFKDFGARFMAQCVDLLA
GNKKLTILTATSGDTGAAVADAFYGLDNVNVMVLYPKGKISELQEKMFTTLGKNIHTVAV
TSDFDACQHLVKQAFDDSDVRDGLALNSANSINISRLLAQICYYFEAVAQAKQAGHHELV
MSVPSGNFGNLTAGLFAKAMGLPIKRFIAATNSNDTVPRYLTGGEWQPHKTVATMSNAMD
VSEPSNWPRVEAICEQMGWPLSLVTGVALSEDATAGALAELYQLGYQSEPHAAIAAHALT
LGLTSKETGVFLGTAHPAKFKDVVDRELNINLPLPPELAAVAQKTILSAELDADFEQLKA
HMFAVLK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaattatataacttaaaacacccatcgcaggtagttaacttcagtcaagcgcttcaa
ctgggtttaggtaaagatagaggattgtttttcccaaagtccattccagtactatccaat
attgatgcattactggcattaccctttgctgagcgaagcaaaaaagtcttgggtgcttgg
ttagcggatgaactcgggcaggagaatgttgataagcttgttgataaagcatttaccttc
gatgtaccactcgttaaggttgatgataaacgtgcttgtttagaactttttcatggtccg
acattagcgtttaaagattttggcgcacggtttatggctcaatgcgttgatttacttgcc
ggcaataaaaaactgactattttaaccgcaacatcgggtgatactggcgctgcagtagcg
gatgcattttacggcctagataacgtcaatgtaatggtgttataccccaaaggtaaaatt
agtgaactgcaagaaaagatgtttactaccttaggtaaaaatattcataccgtggcagta
acatctgactttgatgcttgtcagcatctggttaaacaagcttttgatgacagtgatgtt
cgtgacggcttagcgttaaattctgctaattcgattaatattagtcgtttattagctcag
atatgctattactttgaagcggtagcgcaagcaaaacaagctggacatcatgagcttgtg
atgtctgtacccagtggtaattttggtaacttaaccgctgggttatttgctaaagccatg
gggttaccaattaagcgttttattgctgcaaccaatagtaatgacacggtaccgcgttat
ctcactggtggtgaatggcaaccacataaaaccgtggcgaccatgtctaatgctatggat
gtgtcagagccaagcaattggcctcgtgtagaagcgatttgtgagcaaatgggctggccg
ttatcattggtaactggcgtggctctttctgaagatgccaccgctggcgccttagcagaa
ctttatcagttgggttatcaatcagagccccatgcggcgattgcagctcatgcattaacg
cttgggttaactagtaaagaaactggggtgtttcttggtacagcgcatcctgctaagttt
aaagatgtggttgaccgtgagttgaacattaatttaccgttacctcctgaattagctgcg
gtggcacaaaaaacgattttatcagcagaattagatgctgactttgagcagcttaaagcg
catatgtttgctgtgctaaagtaa

DBGET integrated database retrieval system