KEGG   Shewanella frigidimarina: Sfri_3137Help
Entry
Sfri_3137         CDS       T00395                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sfr  Shewanella frigidimarina
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sfri_3137
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sfri_3137
   00630 Glyoxylate and dicarboxylate metabolism
    Sfri_3137
Enzymes [BR:sfr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sfri_3137
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3753450..3755645)
Genome map
AA seq 731 aa AA seqDB search
MTARIQVGGLHIAQALWQLVDSDICPGTGIDSATFWAKFEDIISEFSPVNVKLLEKRQQL
QQQIDQWHIDHPTKDFDPATYKAFLFEIGYLVPEGEAFQISTENVDHEIAAQAGPQLVVP
VKNARFALNAANARWGSLYDALYGTDAISEDGGAELTKQYNPVRGNKVIAFAKQHLDTAA
PLAQGSHADVTRYYLDAGVLRVQLTDGSTTTLAQTDKCVGYQGSADAPSAILLVNNGLHI
EIQIDPSSVIGGSDRAGVKDLLVEAAVTTIMDCEDSVAAVDAEDKVEVYRNWLGLMQGNL
SASLTKNGKEIVRDLNDDRVYTAANANQSAKTVTLPGRSLLFVRNVGHLMTIDAVLDKNG
NEIPEGILDGMITVLAAMHDLKGNNNGRSNSRKGSVNIVKPKMHGPEEVQFTCDLFTKIE
DALKLPRNTIKVGIMDEERRTTLNLKECIRAAKERVVFINTGFLDRTGDELHTSMLAGPF
VPKSVMKQQKWISAYEDWNVDIGLECGLQGRAQIGKGMWPMPDEMAAMLEQKSAHPKAGA
NTAWVPSPNGAVLHSTHYHQINVADVQQKIKQRPRASIDSLLTIPLLAEGVTLTNEQITF
ELENNAQGILGYVVRWIDQGVGCSKVPDINNVGLMEDRATLRISSQYLANWLEHGICSEA
QVMAALKKMAAVVDTQNAGDPLYTNMAPNFDGIAFKAACDLIFKGKSQPSGYTEPLLHAY
RIQVKAKAKAG
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacgtattcaagtaggtggattacacatagcgcaagcattgtggcaactggtc
gacagtgacatttgcccaggtactggcattgactcagcaaccttttgggcaaaatttgag
gacattattagcgaattttctcccgttaatgtgaagctgttagaaaaaagacaacaacta
caacagcaaattgatcaatggcatattgaccatcccaccaaagattttgaccctgcaaca
tataaagcttttctatttgaaataggttacttggtgcctgagggggaggcttttcaaatt
agcactgaaaatgtcgaccatgaaattgccgcgcaagcgggaccacaacttgtagtgccg
gttaaaaatgctcgctttgcgcttaacgctgccaatgctcgttggggcagcttgtatgat
gcgctatatggcactgacgcgatatctgaagacggtggcgcggagctcactaaacaatac
aacccggtacgcggcaataaagttatcgcttttgccaaacaacacttagatacagctgcg
cccttagcacaaggcagccatgccgatgtgacccgttattacctcgacgcgggtgtgtta
cgggtgcaattaactgacggctctaccacaaccttagcccaaaccgataaatgtgtgggt
taccaaggtagtgccgatgcacccagtgctattttattagttaataatggtctgcatatc
gaaattcaaatagatccaagcagtgttattggtggcagcgatcgcgctggcgttaaagac
ttactggttgaagccgctgtgaccaccattatggactgtgaagactctgtcgccgcagtg
gatgctgaagacaaggttgaagtttatcgcaattggttaggtttgatgcaaggtaattta
tctgcctcgctgactaaaaatggcaaagagatcgttagagatctcaatgacgatcgcgtc
tataccgcagctaatgctaaccagagtgccaaaacagttactttacccggcagaagtttg
ttatttgtgcgtaatgtgggtcacttgatgaccattgatgccgtgctggataaaaatggc
aacgaaataccagaagggatacttgatggcatgatcactgtgcttgctgcgatgcacgac
cttaaaggtaacaataatggtcgtagtaatagccgcaaaggttcggtgaatattgtaaaa
cctaaaatgcatggccctgaagaagtgcaatttacctgtgacctgtttactaagatagaa
gatgcgctcaagctgccgcgtaatacgattaaggtcggcattatggatgaagaacgcaga
acgacactgaatttaaaagagtgcattagggctgcgaaagagcgcgtggtgtttattaat
actggctttcttgatcgcacaggtgatgagctgcatacctcaatgctcgcgggcccgttt
gtgcctaaatcggtgatgaaacagcaaaaatggattagtgcttacgaagattggaatgtc
gatattgggcttgaatgtggcttacaaggtcgcgctcaaatcggtaaaggcatgtggcca
atgcctgatgaaatggcagcaatgcttgaacaaaaatcggctcatcctaaagcgggcgca
aatacagcgtgggtgccgtcgccaaatggtgccgtgttgcattctactcattatcaccaa
attaatgtggcagacgttcagcaaaaaattaaacaacgcccacgtgctagcattgacagt
ttgttgaccattcctttacttgctgaaggggtaacactcaccaatgagcaaattactttt
gaactagaaaataatgcccagggtattttgggctatgttgtgcgctggattgatcaaggt
gtgggttgttcaaaagtgcctgatattaataatgtcggcttgatggaagacagagcaacc
ttacgaatttcatcgcaatatttagctaattggcttgaacatggcatatgcagtgaagca
caagtgatggccgcgttgaaaaaaatggccgctgtggtcgatactcaaaatgcaggtgat
ccgctatacactaatatggcgcctaactttgacggcatcgcctttaaagcggcatgcgat
ctgatttttaaaggaaaatctcagccttctggttacacagagcctttgctacatgcttat
cgaattcaagttaaagctaaagctaaagcaggttaa

DBGET integrated database retrieval system