KEGG   Shewanella frigidimarina: Sfri_3161Help
Entry
Sfri_3161         CDS       T00395                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
sfr  Shewanella frigidimarina
Pathway
sfr00670  One carbon pool by folate
sfr00790  Folate biosynthesis
sfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sfri_3161
   00670 One carbon pool by folate
    Sfri_3161
Enzymes [BR:sfr01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sfri_3161
    1.5.1.50  dihydromonapterin reductase
     Sfri_3161
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 Epimerase GDP_Man_Dehyd KR RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABI72997
JGI: Sfri3161
UniProt: Q07YB7
Position
complement(3785348..3786106)
Genome map
AA seq 252 aa AA seqDB search
MYLSLNKESIMERTILITGVGKRIGYALAKYYLAQGHHVIGTYRTHYDSIEQLGKLGASL
HSCDLTDPASIDGLIIHINEHHARVDTIIHNASDWLPDNSGLSPADTMMRMMQIHVSAPY
QINLALAPLLISAAKSNDDSIGASNIIHITDYVAEKGSKKHIAYAASKAALHNMTLSFAS
LLAPHVKVNSIAPAMILFNEDDGETYKAKALAKAILPKEAGNAEIIVLVDYLHTSHYVTG
RSYAVDGGRHLK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtatctgagcttaaataaagagagcattatggaacgtacaatactgatcactggcgta
ggtaaacgcataggttatgcactggccaaatattatttggctcaaggtcatcatgtcatt
ggcacttatcgcactcattatgacagcattgaacagctcggtaagttgggcgcgagttta
cattcatgcgacttaaccgatccagcatctattgatggattaattattcacatcaatgag
catcatgctcgcgtcgataccattattcataatgcgtcagactggttacccgataacagc
ggcttaagccctgccgatacgatgatgcggatgatgcaaattcacgtatcagcaccgtat
caaatcaatctcgccttagcgccattactgattagcgccgctaaaagcaatgacgacagt
attggtgccagtaacattattcacattaccgattacgttgccgaaaagggcagtaaaaag
cacatcgcctacgccgccagtaaagcagcattgcataatatgacactgtcatttgccagt
ttattagccccacatgtcaaagtgaactccattgctcctgcgatgattttatttaatgaa
gatgacggcgagacatacaaagccaaggcattggctaaagccatattgcccaaagaagct
ggtaatgcggagattattgttttagtcgactacttgcacaccagccattatgttaccggc
cgcagctacgccgttgatggcggcaggcatttaaaataa

DBGET integrated database retrieval system