KEGG   Shewanella frigidimarina: Sfri_3189Help
Entry
Sfri_3189         CDS       T00395                                 

Definition
phospholipase A(1) (EC:3.1.1.32)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
sfr  Shewanella frigidimarina
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sfr00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:sfr00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sfr00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:sfr00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3818182..3819090
Genome map
AA seq 302 aa AA seqDB search
MLMDDAMIKSTQYLGLSLLLLGFSTLALAEDSLVDQRVKRELATSEKPFVLTPHKANYLL
PVTYQTRTNSLPFEVKYPDEDVNIDKLEAKFQISFKFPVWYNVFGDNGHLFFAYTNQSYW
QVYNKDASSPFRETNHEPEVFMLFNNDWKIGGFTNSFLGFGAVHQSNGQTTQLSRSWNRI
YGSAVFDKGPFALGLKVWWRIPEDEKEDINSPDGDDNPDINRYMGNFELTGVYGLDEHRF
TMLLRNNLSSTNRGAVEFTWSYPIIGNLRIYTQYFNGYGESLIDYNHHNQRIGIGIALND
IL
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcttatggatgatgcaatgataaaaagcactcaatatcttggactctcgctattatta
cttggctttagcaccctcgcccttgcagaagactcattagttgatcagcgggtcaaaaga
gaattagccacatcagaaaaaccctttgttctgactccacacaaagccaattacttattg
cctgttacttatcaaacaagaacaaactcgttgccatttgaggttaaatatccagatgaa
gacgtcaatatcgacaagctagaagcaaagtttcaaatcagttttaaattcccggtttgg
tataacgtgtttggcgataatggccatttgttttttgcttataccaatcaatcgtattgg
caagtttataataaagatgcgtcatctcccttccgtgaaaccaatcacgaacctgaagtg
ttcatgctatttaataacgactggaaaattggtggatttactaactcgtttttaggtttt
ggggctgtgcaccaatctaacgggcaaactacacaattatcaagaagttggaatcgaata
tacggcagtgcggtatttgacaaaggtccattcgcattaggacttaaagtctggtggcgt
attcctgaagatgaaaaagaagatattaattcaccagatggcgatgataatccagatatt
aatcgctacatgggtaactttgaattaacaggcgtgtatggcttagatgagcaccgtttt
acaatgctgttacgcaataacttaagcagcacaaatcgtggggcggttgaattcacctgg
agttaccctatcatcggtaatctacgtatatatactcagtattttaacgggtatggtgaa
agcttaattgattataaccatcataatcaacgtattggtattggtattgcgttaaatgac
atcctgtaa

DBGET integrated database retrieval system