KEGG   Shewanella frigidimarina: Sfri_3279Help
Entry
Sfri_3279         CDS       T00395                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sfr  Shewanella frigidimarina
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sfr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sfri_3279
Enzymes [BR:sfr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Sfri_3279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3924351..3924836
Genome map
AA seq 161 aa AA seqDB search
MAVQVYVAIGANLAEPIQQLDVAVLALKALAINNTFTVSAYYGSKPMGDVIQPDYVNAVA
GFQTSLKPIELLDALQEIEHQQGRVRLEHWGPRTLDLDLLLYGQQHINESRLCVPHYGMK
QRSFVLVPLADIAPALILPCNTSLESLISVAMRDELQKLID
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcaagtttatgtcgccataggcgctaatttagccgaaccaatacaacaactc
gatgttgcggtattggcgctaaaagcattggcaataaacaacacttttacagtgtcagct
tattatggttccaagcccatgggtgatgttattcagccagattatgtcaatgctgtcgcg
ggatttcaaacctcgctaaagcccattgagttactcgatgctttacaagagattgagcat
caacaagggcgtgtacggcttgagcattggggacctcgtaccttagatttagatttgtta
ctctatggtcaacaacacatcaacgaatctcgtctttgtgtgcctcattacggcatgaag
caacgcagttttgtgttagttccattagcagacattgcaccagcgctaatattaccttgt
aatacaagccttgaaagccttattagtgtggcaatgcgtgatgaattgcaaaagcttatc
gattaa

DBGET integrated database retrieval system